Cargando…
Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampa...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
SAGE Publications
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8532213/ https://www.ncbi.nlm.nih.gov/pubmed/34692895 http://dx.doi.org/10.1177/2329048X211050711 |
_version_ | 1784587021499498496 |
---|---|
author | Turón-Viñas, Eulàlia Díaz-Gómez, Asunción Coca, Elisabet Dougherty, Lucía Ruiz, Carlos Boronat, Susana |
author_facet | Turón-Viñas, Eulàlia Díaz-Gómez, Asunción Coca, Elisabet Dougherty, Lucía Ruiz, Carlos Boronat, Susana |
author_sort | Turón-Viñas, Eulàlia |
collection | PubMed |
description | Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampanel in this syndrome; however, there is still a lack of evidence of sustained benefit years after the beginning of the treatment. We report a twelve-year-old girl who was diagnosed with Dravet Syndrome when she was 2 years old and has been on perampanel since she was 7. Her genetic test showed a de novo previously described heterozygous SCN1A mutation in the 24th exon (c.4547C>A, p.Ser1516*). She received previous antiseizure drug combinations with little benefit. When perampanel was started, there was a complete resolution of her spontaneous seizures that has continued five years later. More studies are needed to investigate if there is an association between this excellent response and the genotype of our patient. |
format | Online Article Text |
id | pubmed-8532213 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | SAGE Publications |
record_format | MEDLINE/PubMed |
spelling | pubmed-85322132021-10-23 Long-term Efficacy of Perampanel in a Child with Dravet Syndrome Turón-Viñas, Eulàlia Díaz-Gómez, Asunción Coca, Elisabet Dougherty, Lucía Ruiz, Carlos Boronat, Susana Child Neurol Open Case Report Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampanel in this syndrome; however, there is still a lack of evidence of sustained benefit years after the beginning of the treatment. We report a twelve-year-old girl who was diagnosed with Dravet Syndrome when she was 2 years old and has been on perampanel since she was 7. Her genetic test showed a de novo previously described heterozygous SCN1A mutation in the 24th exon (c.4547C>A, p.Ser1516*). She received previous antiseizure drug combinations with little benefit. When perampanel was started, there was a complete resolution of her spontaneous seizures that has continued five years later. More studies are needed to investigate if there is an association between this excellent response and the genotype of our patient. SAGE Publications 2021-10-20 /pmc/articles/PMC8532213/ /pubmed/34692895 http://dx.doi.org/10.1177/2329048X211050711 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by-nc/4.0/This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (https://creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access page (https://us.sagepub.com/en-us/nam/open-access-at-sage). |
spellingShingle | Case Report Turón-Viñas, Eulàlia Díaz-Gómez, Asunción Coca, Elisabet Dougherty, Lucía Ruiz, Carlos Boronat, Susana Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title | Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title_full | Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title_fullStr | Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title_full_unstemmed | Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title_short | Long-term Efficacy of Perampanel in a Child with Dravet Syndrome |
title_sort | long-term efficacy of perampanel in a child with dravet syndrome |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8532213/ https://www.ncbi.nlm.nih.gov/pubmed/34692895 http://dx.doi.org/10.1177/2329048X211050711 |
work_keys_str_mv | AT turonvinaseulalia longtermefficacyofperampanelinachildwithdravetsyndrome AT diazgomezasuncion longtermefficacyofperampanelinachildwithdravetsyndrome AT cocaelisabet longtermefficacyofperampanelinachildwithdravetsyndrome AT doughertylucia longtermefficacyofperampanelinachildwithdravetsyndrome AT ruizcarlos longtermefficacyofperampanelinachildwithdravetsyndrome AT boronatsusana longtermefficacyofperampanelinachildwithdravetsyndrome |