Cargando…

Long-term Efficacy of Perampanel in a Child with Dravet Syndrome

Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampa...

Descripción completa

Detalles Bibliográficos
Autores principales: Turón-Viñas, Eulàlia, Díaz-Gómez, Asunción, Coca, Elisabet, Dougherty, Lucía, Ruiz, Carlos, Boronat, Susana
Formato: Online Artículo Texto
Lenguaje:English
Publicado: SAGE Publications 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8532213/
https://www.ncbi.nlm.nih.gov/pubmed/34692895
http://dx.doi.org/10.1177/2329048X211050711
_version_ 1784587021499498496
author Turón-Viñas, Eulàlia
Díaz-Gómez, Asunción
Coca, Elisabet
Dougherty, Lucía
Ruiz, Carlos
Boronat, Susana
author_facet Turón-Viñas, Eulàlia
Díaz-Gómez, Asunción
Coca, Elisabet
Dougherty, Lucía
Ruiz, Carlos
Boronat, Susana
author_sort Turón-Viñas, Eulàlia
collection PubMed
description Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampanel in this syndrome; however, there is still a lack of evidence of sustained benefit years after the beginning of the treatment. We report a twelve-year-old girl who was diagnosed with Dravet Syndrome when she was 2 years old and has been on perampanel since she was 7. Her genetic test showed a de novo previously described heterozygous SCN1A mutation in the 24th exon (c.4547C>A, p.Ser1516*). She received previous antiseizure drug combinations with little benefit. When perampanel was started, there was a complete resolution of her spontaneous seizures that has continued five years later. More studies are needed to investigate if there is an association between this excellent response and the genotype of our patient.
format Online
Article
Text
id pubmed-8532213
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher SAGE Publications
record_format MEDLINE/PubMed
spelling pubmed-85322132021-10-23 Long-term Efficacy of Perampanel in a Child with Dravet Syndrome Turón-Viñas, Eulàlia Díaz-Gómez, Asunción Coca, Elisabet Dougherty, Lucía Ruiz, Carlos Boronat, Susana Child Neurol Open Case Report Dravet syndrome is a genetic developmental and epileptic encephalopathy (DEE) mostly due to mutations in SCN1A gene. Perampanel is a selective and non-competitive alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor antagonist. There is increasing experience in the use of perampanel in this syndrome; however, there is still a lack of evidence of sustained benefit years after the beginning of the treatment. We report a twelve-year-old girl who was diagnosed with Dravet Syndrome when she was 2 years old and has been on perampanel since she was 7. Her genetic test showed a de novo previously described heterozygous SCN1A mutation in the 24th exon (c.4547C>A, p.Ser1516*). She received previous antiseizure drug combinations with little benefit. When perampanel was started, there was a complete resolution of her spontaneous seizures that has continued five years later. More studies are needed to investigate if there is an association between this excellent response and the genotype of our patient. SAGE Publications 2021-10-20 /pmc/articles/PMC8532213/ /pubmed/34692895 http://dx.doi.org/10.1177/2329048X211050711 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by-nc/4.0/This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (https://creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access page (https://us.sagepub.com/en-us/nam/open-access-at-sage).
spellingShingle Case Report
Turón-Viñas, Eulàlia
Díaz-Gómez, Asunción
Coca, Elisabet
Dougherty, Lucía
Ruiz, Carlos
Boronat, Susana
Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title_full Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title_fullStr Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title_full_unstemmed Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title_short Long-term Efficacy of Perampanel in a Child with Dravet Syndrome
title_sort long-term efficacy of perampanel in a child with dravet syndrome
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8532213/
https://www.ncbi.nlm.nih.gov/pubmed/34692895
http://dx.doi.org/10.1177/2329048X211050711
work_keys_str_mv AT turonvinaseulalia longtermefficacyofperampanelinachildwithdravetsyndrome
AT diazgomezasuncion longtermefficacyofperampanelinachildwithdravetsyndrome
AT cocaelisabet longtermefficacyofperampanelinachildwithdravetsyndrome
AT doughertylucia longtermefficacyofperampanelinachildwithdravetsyndrome
AT ruizcarlos longtermefficacyofperampanelinachildwithdravetsyndrome
AT boronatsusana longtermefficacyofperampanelinachildwithdravetsyndrome