Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma

A young man with smoldering multiple myeloma died of hypotensive shock 2.5 days after severe acute respiratory syndrome coronavirus 2 vaccination. Clinical findings suggested systemic capillary leak syndrome (SCLS); the patient had experienced a previous suspected flare episode. History of SCLS may...

Descripción completa

Detalles Bibliográficos
Autores principales: Choi, Gwang-Jun, Baek, Seon Ha, Kim, Junmo, Kim, Jung Ho, Kwon, Geun-Yong, Kim, Dong Keun, Jung, Yeon Haw, Kim, Sejoong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Centers for Disease Control and Prevention 2021
Materias:
Research Letter
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8544977/
https://www.ncbi.nlm.nih.gov/pubmed/34459725
http://dx.doi.org/10.3201/eid2711.211723
_version_ 1784589929407315968
author Choi, Gwang-Jun
Baek, Seon Ha
Kim, Junmo
Kim, Jung Ho
Kwon, Geun-Yong
Kim, Dong Keun
Jung, Yeon Haw
Kim, Sejoong
author_facet Choi, Gwang-Jun
Baek, Seon Ha
Kim, Junmo
Kim, Jung Ho
Kwon, Geun-Yong
Kim, Dong Keun
Jung, Yeon Haw
Kim, Sejoong
author_sort Choi, Gwang-Jun
collection PubMed
description A young man with smoldering multiple myeloma died of hypotensive shock 2.5 days after severe acute respiratory syndrome coronavirus 2 vaccination. Clinical findings suggested systemic capillary leak syndrome (SCLS); the patient had experienced a previous suspected flare episode. History of SCLS may indicate higher risk for SCLS after receiving this vaccine.
format Online
Article
Text
id pubmed-8544977
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Centers for Disease Control and Prevention
record_format MEDLINE/PubMed
spelling pubmed-85449772021-11-06 Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma Choi, Gwang-Jun Baek, Seon Ha Kim, Junmo Kim, Jung Ho Kwon, Geun-Yong Kim, Dong Keun Jung, Yeon Haw Kim, Sejoong Emerg Infect Dis Research Letter A young man with smoldering multiple myeloma died of hypotensive shock 2.5 days after severe acute respiratory syndrome coronavirus 2 vaccination. Clinical findings suggested systemic capillary leak syndrome (SCLS); the patient had experienced a previous suspected flare episode. History of SCLS may indicate higher risk for SCLS after receiving this vaccine. Centers for Disease Control and Prevention 2021-11 /pmc/articles/PMC8544977/ /pubmed/34459725 http://dx.doi.org/10.3201/eid2711.211723 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited.
spellingShingle Research Letter
Choi, Gwang-Jun
Baek, Seon Ha
Kim, Junmo
Kim, Jung Ho
Kwon, Geun-Yong
Kim, Dong Keun
Jung, Yeon Haw
Kim, Sejoong
Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title_full Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title_fullStr Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title_full_unstemmed Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title_short Fatal Systemic Capillary Leak Syndrome after SARS-CoV-2Vaccination in Patient with Multiple Myeloma
title_sort fatal systemic capillary leak syndrome after sars-cov-2vaccination in patient with multiple myeloma
topic Research Letter
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8544977/
https://www.ncbi.nlm.nih.gov/pubmed/34459725
http://dx.doi.org/10.3201/eid2711.211723
work_keys_str_mv AT choigwangjun fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT baekseonha fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT kimjunmo fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT kimjungho fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT kwongeunyong fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT kimdongkeun fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT jungyeonhaw fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma
AT kimsejoong fatalsystemiccapillaryleaksyndromeaftersarscov2vaccinationinpatientwithmultiplemyeloma

Ejemplares similares