Cargando…
Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review
BACKGROUND: Implementation and uptake of novel and cost-effective medicines can improve patient health outcomes and healthcare efficiency. However, the uptake of new medicines into practice faces a wide range of obstacles. Earlier reviews provided insights into determinants for new medicine uptake (...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8570007/ https://www.ncbi.nlm.nih.gov/pubmed/34740338 http://dx.doi.org/10.1186/s12913-021-07196-4 |
_version_ | 1784594755950215168 |
---|---|
author | Medlinskiene, Kristina Tomlinson, Justine Marques, Iuri Richardson, Sue Stirling, Katherine Petty, Duncan |
author_facet | Medlinskiene, Kristina Tomlinson, Justine Marques, Iuri Richardson, Sue Stirling, Katherine Petty, Duncan |
author_sort | Medlinskiene, Kristina |
collection | PubMed |
description | BACKGROUND: Implementation and uptake of novel and cost-effective medicines can improve patient health outcomes and healthcare efficiency. However, the uptake of new medicines into practice faces a wide range of obstacles. Earlier reviews provided insights into determinants for new medicine uptake (such as medicine, prescriber, patient, organization, and external environment factors). However, the methodological approaches used had limitations (e.g., single author, narrative review, narrow search, no quality assessment of reviewed evidence). This systematic review aims to identify barriers and facilitators affecting the uptake of new medicines into clinical practice and identify areas for future research. METHOD: A systematic search of literature was undertaken within seven databases: Medline, EMBASE, Web of Science, CINAHL, Cochrane Library, SCOPUS, and PsychINFO. Included in the review were qualitative, quantitative, and mixed-methods studies focused on adult participants (18 years and older) requiring or taking new medicine(s) for any condition, in the context of healthcare organizations and which identified factors affecting the uptake of new medicines. The methodological quality was assessed using QATSDD tool. A narrative synthesis of reported factors was conducted using framework analysis and a conceptual framework was utilised to group them. RESULTS: A total of 66 studies were included. Most studies (n = 62) were quantitative and used secondary data (n = 46) from various databases, e.g., insurance databases. The identified factors had a varied impact on the uptake of the different studied new medicines. Differently from earlier reviews, patient factors (patient education, engagement with treatment, therapy preferences), cost of new medicine, reimbursement and formulary conditions, and guidelines were suggested to influence the uptake. Also, the review highlighted that health economics, wider organizational factors, and underlying behaviours of adopters were not or under explored. CONCLUSION: This systematic review has identified a broad range of factors affecting the uptake of new medicines within healthcare organizations, which were grouped into patient, prescriber, medicine, organizational, and external environment factors. This systematic review also identifies additional factors affecting new medicine use not reported in earlier reviews, which included patient influence and education level, cost of new medicines, formulary and reimbursement restrictions, and guidelines. REGISTRATION: PROSPERO database (CRD42018108536). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-07196-4. |
format | Online Article Text |
id | pubmed-8570007 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-85700072021-11-08 Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review Medlinskiene, Kristina Tomlinson, Justine Marques, Iuri Richardson, Sue Stirling, Katherine Petty, Duncan BMC Health Serv Res Research Article BACKGROUND: Implementation and uptake of novel and cost-effective medicines can improve patient health outcomes and healthcare efficiency. However, the uptake of new medicines into practice faces a wide range of obstacles. Earlier reviews provided insights into determinants for new medicine uptake (such as medicine, prescriber, patient, organization, and external environment factors). However, the methodological approaches used had limitations (e.g., single author, narrative review, narrow search, no quality assessment of reviewed evidence). This systematic review aims to identify barriers and facilitators affecting the uptake of new medicines into clinical practice and identify areas for future research. METHOD: A systematic search of literature was undertaken within seven databases: Medline, EMBASE, Web of Science, CINAHL, Cochrane Library, SCOPUS, and PsychINFO. Included in the review were qualitative, quantitative, and mixed-methods studies focused on adult participants (18 years and older) requiring or taking new medicine(s) for any condition, in the context of healthcare organizations and which identified factors affecting the uptake of new medicines. The methodological quality was assessed using QATSDD tool. A narrative synthesis of reported factors was conducted using framework analysis and a conceptual framework was utilised to group them. RESULTS: A total of 66 studies were included. Most studies (n = 62) were quantitative and used secondary data (n = 46) from various databases, e.g., insurance databases. The identified factors had a varied impact on the uptake of the different studied new medicines. Differently from earlier reviews, patient factors (patient education, engagement with treatment, therapy preferences), cost of new medicine, reimbursement and formulary conditions, and guidelines were suggested to influence the uptake. Also, the review highlighted that health economics, wider organizational factors, and underlying behaviours of adopters were not or under explored. CONCLUSION: This systematic review has identified a broad range of factors affecting the uptake of new medicines within healthcare organizations, which were grouped into patient, prescriber, medicine, organizational, and external environment factors. This systematic review also identifies additional factors affecting new medicine use not reported in earlier reviews, which included patient influence and education level, cost of new medicines, formulary and reimbursement restrictions, and guidelines. REGISTRATION: PROSPERO database (CRD42018108536). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-07196-4. BioMed Central 2021-11-05 /pmc/articles/PMC8570007/ /pubmed/34740338 http://dx.doi.org/10.1186/s12913-021-07196-4 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Medlinskiene, Kristina Tomlinson, Justine Marques, Iuri Richardson, Sue Stirling, Katherine Petty, Duncan Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title | Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title_full | Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title_fullStr | Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title_full_unstemmed | Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title_short | Barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
title_sort | barriers and facilitators to the uptake of new medicines into clinical practice: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8570007/ https://www.ncbi.nlm.nih.gov/pubmed/34740338 http://dx.doi.org/10.1186/s12913-021-07196-4 |
work_keys_str_mv | AT medlinskienekristina barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview AT tomlinsonjustine barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview AT marquesiuri barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview AT richardsonsue barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview AT stirlingkatherine barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview AT pettyduncan barriersandfacilitatorstotheuptakeofnewmedicinesintoclinicalpracticeasystematicreview |