Cargando…
European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus
BACKGROUND: Technology-supported rehabilitation can help alleviate the increasing need for cost-effective rehabilitation of neurological conditions, but use in clinical practice remains limited. Agreement on a core set of reliable, valid and accessible outcome measures to assess rehabilitation outco...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8573909/ https://www.ncbi.nlm.nih.gov/pubmed/34749752 http://dx.doi.org/10.1186/s12984-021-00951-y |
_version_ | 1784595512660328448 |
---|---|
author | Prange-Lasonder, Gerdienke B. Alt Murphy, Margit Lamers, Ilse Hughes, Ann-Marie Buurke, Jaap H. Feys, Peter Keller, Thierry Klamroth-Marganska, Verena Tarkka, Ina M. Timmermans, Annick Burridge, Jane H. |
author_facet | Prange-Lasonder, Gerdienke B. Alt Murphy, Margit Lamers, Ilse Hughes, Ann-Marie Buurke, Jaap H. Feys, Peter Keller, Thierry Klamroth-Marganska, Verena Tarkka, Ina M. Timmermans, Annick Burridge, Jane H. |
author_sort | Prange-Lasonder, Gerdienke B. |
collection | PubMed |
description | BACKGROUND: Technology-supported rehabilitation can help alleviate the increasing need for cost-effective rehabilitation of neurological conditions, but use in clinical practice remains limited. Agreement on a core set of reliable, valid and accessible outcome measures to assess rehabilitation outcomes is needed to generate strong evidence about effectiveness of rehabilitation approaches, including technologies. This paper collates and synthesizes a core set from multiple sources; combining existing evidence, clinical practice guidelines and expert consensus into European recommendations for Clinical Assessment of Upper Limb In Neurorehabilitation (CAULIN). METHODS: Data from systematic reviews, clinical practice guidelines and expert consensus (Delphi methodology) were systematically extracted and synthesized using strength of evidence rating criteria, in addition to recommendations on assessment procedures. Three sets were defined: a core set: strong evidence for validity, reliability, responsiveness and clinical utility AND recommended by at least two sources; an extended set: strong evidence OR recommended by at least two sources and a supplementary set: some evidence OR recommended by at least one of the sources. RESULTS: In total, 12 measures (with primary focus on stroke) were included, encompassing body function and activity level of the International Classification of Functioning and Health. The core set recommended for clinical practice and research: Fugl-Meyer Assessment of Upper Extremity (FMA-UE) and Action Research Arm Test (ARAT); the extended set recommended for clinical practice and/or clinical research: kinematic measures, Box and Block Test (BBT), Chedoke Arm Hand Activity Inventory (CAHAI), Wolf Motor Function Test (WMFT), Nine Hole Peg Test (NHPT) and ABILHAND; the supplementary set recommended for research or specific occasions: Motricity Index (MI); Chedoke-McMaster Stroke Assessment (CMSA), Stroke Rehabilitation Assessment Movement (STREAM), Frenchay Arm Test (FAT), Motor Assessment Scale (MAS) and body-worn movement sensors. Assessments should be conducted at pre-defined regular intervals by trained personnel. Global measures should be applied within 24 h of hospital admission and upper limb specific measures within 1 week. CONCLUSIONS: The CAULIN recommendations for outcome measures and assessment procedures provide a clear, simple, evidence-based three-level structure for upper limb assessment in neurological rehabilitation. Widespread adoption and sustained use will improve quality of clinical practice and facilitate meta-analysis, critical for the advancement of technology-supported neurorehabilitation. |
format | Online Article Text |
id | pubmed-8573909 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-85739092021-11-08 European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus Prange-Lasonder, Gerdienke B. Alt Murphy, Margit Lamers, Ilse Hughes, Ann-Marie Buurke, Jaap H. Feys, Peter Keller, Thierry Klamroth-Marganska, Verena Tarkka, Ina M. Timmermans, Annick Burridge, Jane H. J Neuroeng Rehabil Research BACKGROUND: Technology-supported rehabilitation can help alleviate the increasing need for cost-effective rehabilitation of neurological conditions, but use in clinical practice remains limited. Agreement on a core set of reliable, valid and accessible outcome measures to assess rehabilitation outcomes is needed to generate strong evidence about effectiveness of rehabilitation approaches, including technologies. This paper collates and synthesizes a core set from multiple sources; combining existing evidence, clinical practice guidelines and expert consensus into European recommendations for Clinical Assessment of Upper Limb In Neurorehabilitation (CAULIN). METHODS: Data from systematic reviews, clinical practice guidelines and expert consensus (Delphi methodology) were systematically extracted and synthesized using strength of evidence rating criteria, in addition to recommendations on assessment procedures. Three sets were defined: a core set: strong evidence for validity, reliability, responsiveness and clinical utility AND recommended by at least two sources; an extended set: strong evidence OR recommended by at least two sources and a supplementary set: some evidence OR recommended by at least one of the sources. RESULTS: In total, 12 measures (with primary focus on stroke) were included, encompassing body function and activity level of the International Classification of Functioning and Health. The core set recommended for clinical practice and research: Fugl-Meyer Assessment of Upper Extremity (FMA-UE) and Action Research Arm Test (ARAT); the extended set recommended for clinical practice and/or clinical research: kinematic measures, Box and Block Test (BBT), Chedoke Arm Hand Activity Inventory (CAHAI), Wolf Motor Function Test (WMFT), Nine Hole Peg Test (NHPT) and ABILHAND; the supplementary set recommended for research or specific occasions: Motricity Index (MI); Chedoke-McMaster Stroke Assessment (CMSA), Stroke Rehabilitation Assessment Movement (STREAM), Frenchay Arm Test (FAT), Motor Assessment Scale (MAS) and body-worn movement sensors. Assessments should be conducted at pre-defined regular intervals by trained personnel. Global measures should be applied within 24 h of hospital admission and upper limb specific measures within 1 week. CONCLUSIONS: The CAULIN recommendations for outcome measures and assessment procedures provide a clear, simple, evidence-based three-level structure for upper limb assessment in neurological rehabilitation. Widespread adoption and sustained use will improve quality of clinical practice and facilitate meta-analysis, critical for the advancement of technology-supported neurorehabilitation. BioMed Central 2021-11-08 /pmc/articles/PMC8573909/ /pubmed/34749752 http://dx.doi.org/10.1186/s12984-021-00951-y Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Prange-Lasonder, Gerdienke B. Alt Murphy, Margit Lamers, Ilse Hughes, Ann-Marie Buurke, Jaap H. Feys, Peter Keller, Thierry Klamroth-Marganska, Verena Tarkka, Ina M. Timmermans, Annick Burridge, Jane H. European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title | European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title_full | European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title_fullStr | European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title_full_unstemmed | European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title_short | European evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (CAULIN): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
title_sort | european evidence-based recommendations for clinical assessment of upper limb in neurorehabilitation (caulin): data synthesis from systematic reviews, clinical practice guidelines and expert consensus |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8573909/ https://www.ncbi.nlm.nih.gov/pubmed/34749752 http://dx.doi.org/10.1186/s12984-021-00951-y |
work_keys_str_mv | AT prangelasondergerdienkeb europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT altmurphymargit europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT lamersilse europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT hughesannmarie europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT buurkejaaph europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT feyspeter europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT kellerthierry europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT klamrothmarganskaverena europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT tarkkainam europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT timmermansannick europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus AT burridgejaneh europeanevidencebasedrecommendationsforclinicalassessmentofupperlimbinneurorehabilitationcaulindatasynthesisfromsystematicreviewsclinicalpracticeguidelinesandexpertconsensus |