Cargando…
The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study
BACKGROUND: It has been reported that dietary fats and genetic factors in individuals are associated with the pattern of fat distribution. This study aimed to evaluate the interaction between dietary fats intake and Caveolin1 (CAV-1) rs 3807s992 polymorphism with fat distribution in overweight and o...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8579626/ https://www.ncbi.nlm.nih.gov/pubmed/34753501 http://dx.doi.org/10.1186/s12920-021-01114-7 |
_version_ | 1784596464966565888 |
---|---|
author | Aali, Yasaman Shiraseb, Farideh Abaj, Faezeh koohdani, Fariba Mirzaei, Khadijeh |
author_facet | Aali, Yasaman Shiraseb, Farideh Abaj, Faezeh koohdani, Fariba Mirzaei, Khadijeh |
author_sort | Aali, Yasaman |
collection | PubMed |
description | BACKGROUND: It has been reported that dietary fats and genetic factors in individuals are associated with the pattern of fat distribution. This study aimed to evaluate the interaction between dietary fats intake and Caveolin1 (CAV-1) rs 3807s992 polymorphism with fat distribution in overweight and obese women. METHODS: A total of 221 participants were included in the current cross-sectional study. Body composition, biochemical parameters were evaluated by body composition analyzer and Pars Azmoon kits and genotypes determination was performed by PCR–RFLP, dietary fats were measured using a validated semi-quantitative food frequency questionnaire (FAQ). RESULTS: The frequency of GG, AA and AG genotypes were 53.1, 24.6, and 22.3%, respectively, and the mean intake of total dietary fat intake was 97.47 ± 36.87 g. There was positive significant interaction between total fat intake and AA genotype on visceral fat level (p = 0.001), trunk fat (p = 0.01) and waist circumference (p = 0.05), positive significant interaction between total fat intake and AG genotype on the waist to hip ratio (WHR) (p = 0.02) and visceral fat level (p = 0.05), positive borderline significant interaction between saturated fatty acid and AA genotype on the trunk fat (p = 0.06), and between trans-fatty acids and AG genotype on WHR (p = 0.04), visceral fat level (p = 0.01), and between monounsaturated fatty acid and AG genotype on WHR (p = 0.04), and a borderline interaction between polyunsaturated fatty acid and AA genotypes on visceral fat level (p = 0.06), negative significant interaction between AG genotypes and linolenic acid on WHR (p = 0.04), borderline significant interaction between ALA and AG genotype on WHR (p = 0.06). CONCLUSIONS: Our findings showed that CAV-1 rs 3807992 polymorphism and dietary fats were associated with fat distributions in individuals. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-021-01114-7. |
format | Online Article Text |
id | pubmed-8579626 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-85796262021-11-10 The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study Aali, Yasaman Shiraseb, Farideh Abaj, Faezeh koohdani, Fariba Mirzaei, Khadijeh BMC Med Genomics Research BACKGROUND: It has been reported that dietary fats and genetic factors in individuals are associated with the pattern of fat distribution. This study aimed to evaluate the interaction between dietary fats intake and Caveolin1 (CAV-1) rs 3807s992 polymorphism with fat distribution in overweight and obese women. METHODS: A total of 221 participants were included in the current cross-sectional study. Body composition, biochemical parameters were evaluated by body composition analyzer and Pars Azmoon kits and genotypes determination was performed by PCR–RFLP, dietary fats were measured using a validated semi-quantitative food frequency questionnaire (FAQ). RESULTS: The frequency of GG, AA and AG genotypes were 53.1, 24.6, and 22.3%, respectively, and the mean intake of total dietary fat intake was 97.47 ± 36.87 g. There was positive significant interaction between total fat intake and AA genotype on visceral fat level (p = 0.001), trunk fat (p = 0.01) and waist circumference (p = 0.05), positive significant interaction between total fat intake and AG genotype on the waist to hip ratio (WHR) (p = 0.02) and visceral fat level (p = 0.05), positive borderline significant interaction between saturated fatty acid and AA genotype on the trunk fat (p = 0.06), and between trans-fatty acids and AG genotype on WHR (p = 0.04), visceral fat level (p = 0.01), and between monounsaturated fatty acid and AG genotype on WHR (p = 0.04), and a borderline interaction between polyunsaturated fatty acid and AA genotypes on visceral fat level (p = 0.06), negative significant interaction between AG genotypes and linolenic acid on WHR (p = 0.04), borderline significant interaction between ALA and AG genotype on WHR (p = 0.06). CONCLUSIONS: Our findings showed that CAV-1 rs 3807992 polymorphism and dietary fats were associated with fat distributions in individuals. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-021-01114-7. BioMed Central 2021-11-09 /pmc/articles/PMC8579626/ /pubmed/34753501 http://dx.doi.org/10.1186/s12920-021-01114-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Aali, Yasaman Shiraseb, Farideh Abaj, Faezeh koohdani, Fariba Mirzaei, Khadijeh The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title | The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title_full | The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title_fullStr | The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title_full_unstemmed | The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title_short | The interactions between dietary fats intake and Caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
title_sort | interactions between dietary fats intake and caveolin 1 rs 3807992 polymorphism with fat distribution in overweight and obese women: a cross-sectional study |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8579626/ https://www.ncbi.nlm.nih.gov/pubmed/34753501 http://dx.doi.org/10.1186/s12920-021-01114-7 |
work_keys_str_mv | AT aaliyasaman theinteractionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT shirasebfarideh theinteractionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT abajfaezeh theinteractionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT koohdanifariba theinteractionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT mirzaeikhadijeh theinteractionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT aaliyasaman interactionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT shirasebfarideh interactionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT abajfaezeh interactionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT koohdanifariba interactionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy AT mirzaeikhadijeh interactionsbetweendietaryfatsintakeandcaveolin1rs3807992polymorphismwithfatdistributioninoverweightandobesewomenacrosssectionalstudy |