Cargando…

Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells

Polyphenols from olive oil are endowed with several biological activities. Chemical modifications have been recently applied to these compounds to improve their therapeutic activity in different pathological settings, including cancer. Herein, we describe the in vitro effects on multiple myeloma (MM...

Descripción completa

Detalles Bibliográficos
Autores principales: Todoerti, Katia, Gallo Cantafio, Maria Eugenia, Oliverio, Manuela, Juli, Giada, Rocca, Carmine, Citraro, Rita, Tassone, Pierfrancesco, Procopio, Antonio, De Sarro, Giovambattista, Neri, Antonino, Viglietto, Giuseppe, Amodio, Nicola
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8584245/
https://www.ncbi.nlm.nih.gov/pubmed/34769070
http://dx.doi.org/10.3390/ijms222111639
_version_ 1784597403023704064
author Todoerti, Katia
Gallo Cantafio, Maria Eugenia
Oliverio, Manuela
Juli, Giada
Rocca, Carmine
Citraro, Rita
Tassone, Pierfrancesco
Procopio, Antonio
De Sarro, Giovambattista
Neri, Antonino
Viglietto, Giuseppe
Amodio, Nicola
author_facet Todoerti, Katia
Gallo Cantafio, Maria Eugenia
Oliverio, Manuela
Juli, Giada
Rocca, Carmine
Citraro, Rita
Tassone, Pierfrancesco
Procopio, Antonio
De Sarro, Giovambattista
Neri, Antonino
Viglietto, Giuseppe
Amodio, Nicola
author_sort Todoerti, Katia
collection PubMed
description Polyphenols from olive oil are endowed with several biological activities. Chemical modifications have been recently applied to these compounds to improve their therapeutic activity in different pathological settings, including cancer. Herein, we describe the in vitro effects on multiple myeloma (MM) cells of oleil hydroxytyrosol (HTOL), a synthetic fatty ester of natural hydroxytyrosol with oleic acid. HTOL reduced the viability of various human MM cell lines (HMCLs), even when co-cultured with bone marrow stromal cells, triggering ER stress, UPR and apoptosis, while it was not cytotoxic against healthy peripheral blood mononuclear cells or B lymphocytes. Whole-transcriptome profiling of HTOL-treated MM cells, coupled with protein expression analyses, indicate that HTOL antagonizes key survival pathways for malignant plasma cells, including the undruggable IRF4–c-MYC oncogenic axis. Accordingly, c-MYC gain- and loss-of-function strategies demonstrate that HTOL anti-tumor activity was, at least in part, due to c-MYC targeting. Taken together, these findings underscore the anti-MM potential of HTOL, providing the molecular framework for further investigation of HTOL-based treatments as novel anti-cancer agents.
format Online
Article
Text
id pubmed-8584245
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-85842452021-11-12 Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells Todoerti, Katia Gallo Cantafio, Maria Eugenia Oliverio, Manuela Juli, Giada Rocca, Carmine Citraro, Rita Tassone, Pierfrancesco Procopio, Antonio De Sarro, Giovambattista Neri, Antonino Viglietto, Giuseppe Amodio, Nicola Int J Mol Sci Article Polyphenols from olive oil are endowed with several biological activities. Chemical modifications have been recently applied to these compounds to improve their therapeutic activity in different pathological settings, including cancer. Herein, we describe the in vitro effects on multiple myeloma (MM) cells of oleil hydroxytyrosol (HTOL), a synthetic fatty ester of natural hydroxytyrosol with oleic acid. HTOL reduced the viability of various human MM cell lines (HMCLs), even when co-cultured with bone marrow stromal cells, triggering ER stress, UPR and apoptosis, while it was not cytotoxic against healthy peripheral blood mononuclear cells or B lymphocytes. Whole-transcriptome profiling of HTOL-treated MM cells, coupled with protein expression analyses, indicate that HTOL antagonizes key survival pathways for malignant plasma cells, including the undruggable IRF4–c-MYC oncogenic axis. Accordingly, c-MYC gain- and loss-of-function strategies demonstrate that HTOL anti-tumor activity was, at least in part, due to c-MYC targeting. Taken together, these findings underscore the anti-MM potential of HTOL, providing the molecular framework for further investigation of HTOL-based treatments as novel anti-cancer agents. MDPI 2021-10-28 /pmc/articles/PMC8584245/ /pubmed/34769070 http://dx.doi.org/10.3390/ijms222111639 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Todoerti, Katia
Gallo Cantafio, Maria Eugenia
Oliverio, Manuela
Juli, Giada
Rocca, Carmine
Citraro, Rita
Tassone, Pierfrancesco
Procopio, Antonio
De Sarro, Giovambattista
Neri, Antonino
Viglietto, Giuseppe
Amodio, Nicola
Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title_full Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title_fullStr Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title_full_unstemmed Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title_short Oleil Hydroxytyrosol (HTOL) Exerts Anti-Myeloma Activity by Antagonizing Key Survival Pathways in Malignant Plasma Cells
title_sort oleil hydroxytyrosol (htol) exerts anti-myeloma activity by antagonizing key survival pathways in malignant plasma cells
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8584245/
https://www.ncbi.nlm.nih.gov/pubmed/34769070
http://dx.doi.org/10.3390/ijms222111639
work_keys_str_mv AT todoertikatia oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT gallocantafiomariaeugenia oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT oliveriomanuela oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT juligiada oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT roccacarmine oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT citrarorita oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT tassonepierfrancesco oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT procopioantonio oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT desarrogiovambattista oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT neriantonino oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT vigliettogiuseppe oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells
AT amodionicola oleilhydroxytyrosolhtolexertsantimyelomaactivitybyantagonizingkeysurvivalpathwaysinmalignantplasmacells