Cargando…
Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate th...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8585391/ https://www.ncbi.nlm.nih.gov/pubmed/34772001 http://dx.doi.org/10.3390/ma14216468 |
_version_ | 1784597678525513728 |
---|---|
author | Islam, Faridul Wang, Jialong Tahmasebi, Arash Wang, Rou Moghtaderi, Behdad Yu, Jianglong |
author_facet | Islam, Faridul Wang, Jialong Tahmasebi, Arash Wang, Rou Moghtaderi, Behdad Yu, Jianglong |
author_sort | Islam, Faridul |
collection | PubMed |
description | A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate the properties of the FLG sample. A well-developed microstructure and higher graphitization degree were achieved under microwave heating at 1300 °C using the S5% dual (Fe-Ni) catalyst for 20 min. In addition, the synthesized FLG sample encompassed the Raman spectrum 2D band at 2700 cm(−1), which showed the existence of a few-layer graphene structure. The high-resolution TEM (transmission electron microscopy) image investigation of the S5% Fe-Ni sample confirmed that the fabricated FLG material consisted of two to seven graphitic layers, promoting the fast lithium-ion diffusion into the inner surface. The S5% Fe-Ni composite material delivered a high reversible capacity of 287.91 mAhg(−1) at 0.1 C with a higher Coulombic efficiency of 99.9%. In contrast, the single catalyst of S10% Fe contained a reversible capacity of 260.13 mAhg(−1) at 0.1 C with 97.96% Coulombic efficiency. Furthermore, the dual catalyst-loaded FLG sample demonstrated a high capacity—up to 95% of the initial reversible capacity retention—after 100 cycles. This study revealed the potential feasibility of producing FLG materials from bituminous coal used in a broad range as anode materials for lithium-ion batteries (LIBs). |
format | Online Article Text |
id | pubmed-8585391 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-85853912021-11-12 Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries Islam, Faridul Wang, Jialong Tahmasebi, Arash Wang, Rou Moghtaderi, Behdad Yu, Jianglong Materials (Basel) Article A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate the properties of the FLG sample. A well-developed microstructure and higher graphitization degree were achieved under microwave heating at 1300 °C using the S5% dual (Fe-Ni) catalyst for 20 min. In addition, the synthesized FLG sample encompassed the Raman spectrum 2D band at 2700 cm(−1), which showed the existence of a few-layer graphene structure. The high-resolution TEM (transmission electron microscopy) image investigation of the S5% Fe-Ni sample confirmed that the fabricated FLG material consisted of two to seven graphitic layers, promoting the fast lithium-ion diffusion into the inner surface. The S5% Fe-Ni composite material delivered a high reversible capacity of 287.91 mAhg(−1) at 0.1 C with a higher Coulombic efficiency of 99.9%. In contrast, the single catalyst of S10% Fe contained a reversible capacity of 260.13 mAhg(−1) at 0.1 C with 97.96% Coulombic efficiency. Furthermore, the dual catalyst-loaded FLG sample demonstrated a high capacity—up to 95% of the initial reversible capacity retention—after 100 cycles. This study revealed the potential feasibility of producing FLG materials from bituminous coal used in a broad range as anode materials for lithium-ion batteries (LIBs). MDPI 2021-10-28 /pmc/articles/PMC8585391/ /pubmed/34772001 http://dx.doi.org/10.3390/ma14216468 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Islam, Faridul Wang, Jialong Tahmasebi, Arash Wang, Rou Moghtaderi, Behdad Yu, Jianglong Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title | Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title_full | Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title_fullStr | Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title_full_unstemmed | Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title_short | Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries |
title_sort | microwave-assisted coal-derived few-layer graphene as an anode material for lithium-ion batteries |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8585391/ https://www.ncbi.nlm.nih.gov/pubmed/34772001 http://dx.doi.org/10.3390/ma14216468 |
work_keys_str_mv | AT islamfaridul microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT wangjialong microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT tahmasebiarash microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT wangrou microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT moghtaderibehdad microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT yujianglong microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries |