Cargando…

Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report

BACKGROUND: Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which can lead...

Descripción completa

Detalles Bibliográficos
Autores principales: Omoyinmi, Ebun, Rowczenio, Dorota, Sebire, Neil, Brogan, Paul A., Eleftheriou, Despina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8607720/
https://www.ncbi.nlm.nih.gov/pubmed/34809655
http://dx.doi.org/10.1186/s12969-021-00645-8
_version_ 1784602617542868992
author Omoyinmi, Ebun
Rowczenio, Dorota
Sebire, Neil
Brogan, Paul A.
Eleftheriou, Despina
author_facet Omoyinmi, Ebun
Rowczenio, Dorota
Sebire, Neil
Brogan, Paul A.
Eleftheriou, Despina
author_sort Omoyinmi, Ebun
collection PubMed
description BACKGROUND: Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which can lead to diagnostic delay. We report the case of a child presenting with vasculitis that was found by genetic testing to be caused by MKD, and now add this autoinflammatory disease to the ever-expanding list of causes of monogenic vasculitides. CASE PRESENTATION: A 2-year-old male presented with an acute 7-day history of high-grade fever, abdominal pain, diarrhoea, rectal bleeding and extensive purpuric and necrotic lesions, predominantly affecting the lower limbs. He had been suffering from recurrent episodes of fever from early in infancy, associated with maculopapular/petechial rashes triggered by intercurrent infection, and after vaccines. Extensive infection screen was negative. Skin biopsy revealed small vessel vasculitis. Visceral digital subtraction arteriography was normal. With a diagnosis of severe idiopathic cutaneous vasculitis, he was treated with corticosteroids and mycophenolate mofetil. Despite that his acute phase reactants remained elevated, fever persisted and the vasculitic lesions progressed. Next-generation sequencing revealed compound heterozygous mutation in MVK c.928G > A (p.V310M) and c.1129G > A (p.V377I) while reduced mevalonate enzyme activity was confirmed suggesting a diagnosis of MKD as a cause of the severe vasculitis. Prompt targeted treatment with IL-1 blockade was initiated preventing escalation to more toxic vasculitis therapies and reducing unnecessary exposure to cytotoxic treatment. CONCLUSIONS: Our report highlights the broad clinical phenotype of MKD that includes severe cutaneous vasculitis and emphasizes the need to consider early genetic screening for young children presenting with vasculitis to exclude a monogenic vasculitis which may be amenable to targeted treatment.
format Online
Article
Text
id pubmed-8607720
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-86077202021-11-22 Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report Omoyinmi, Ebun Rowczenio, Dorota Sebire, Neil Brogan, Paul A. Eleftheriou, Despina Pediatr Rheumatol Online J Case Report BACKGROUND: Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which can lead to diagnostic delay. We report the case of a child presenting with vasculitis that was found by genetic testing to be caused by MKD, and now add this autoinflammatory disease to the ever-expanding list of causes of monogenic vasculitides. CASE PRESENTATION: A 2-year-old male presented with an acute 7-day history of high-grade fever, abdominal pain, diarrhoea, rectal bleeding and extensive purpuric and necrotic lesions, predominantly affecting the lower limbs. He had been suffering from recurrent episodes of fever from early in infancy, associated with maculopapular/petechial rashes triggered by intercurrent infection, and after vaccines. Extensive infection screen was negative. Skin biopsy revealed small vessel vasculitis. Visceral digital subtraction arteriography was normal. With a diagnosis of severe idiopathic cutaneous vasculitis, he was treated with corticosteroids and mycophenolate mofetil. Despite that his acute phase reactants remained elevated, fever persisted and the vasculitic lesions progressed. Next-generation sequencing revealed compound heterozygous mutation in MVK c.928G > A (p.V310M) and c.1129G > A (p.V377I) while reduced mevalonate enzyme activity was confirmed suggesting a diagnosis of MKD as a cause of the severe vasculitis. Prompt targeted treatment with IL-1 blockade was initiated preventing escalation to more toxic vasculitis therapies and reducing unnecessary exposure to cytotoxic treatment. CONCLUSIONS: Our report highlights the broad clinical phenotype of MKD that includes severe cutaneous vasculitis and emphasizes the need to consider early genetic screening for young children presenting with vasculitis to exclude a monogenic vasculitis which may be amenable to targeted treatment. BioMed Central 2021-11-22 /pmc/articles/PMC8607720/ /pubmed/34809655 http://dx.doi.org/10.1186/s12969-021-00645-8 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Case Report
Omoyinmi, Ebun
Rowczenio, Dorota
Sebire, Neil
Brogan, Paul A.
Eleftheriou, Despina
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title_full Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title_fullStr Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title_full_unstemmed Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title_short Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
title_sort vasculitis in a patient with mevalonate kinase deficiency (mkd): a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8607720/
https://www.ncbi.nlm.nih.gov/pubmed/34809655
http://dx.doi.org/10.1186/s12969-021-00645-8
work_keys_str_mv AT omoyinmiebun vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport
AT rowczeniodorota vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport
AT sebireneil vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport
AT broganpaula vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport
AT eleftherioudespina vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport