Cargando…
Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8634684/ https://www.ncbi.nlm.nih.gov/pubmed/34867407 http://dx.doi.org/10.3389/fphar.2021.777083 |
_version_ | 1784608171303632896 |
---|---|
author | Sardu, Celestino Massetti, Massimo Testa, Nicola Martino, Luigi Di Castellano, Gaetano Turriziani, Fabrizio Sasso, Ferdinando Carlo Torella, Michele De Feo, Marisa Santulli, Gaetano Paolisso, Giuseppe Marfella, Raffaele |
author_facet | Sardu, Celestino Massetti, Massimo Testa, Nicola Martino, Luigi Di Castellano, Gaetano Turriziani, Fabrizio Sasso, Ferdinando Carlo Torella, Michele De Feo, Marisa Santulli, Gaetano Paolisso, Giuseppe Marfella, Raffaele |
author_sort | Sardu, Celestino |
collection | PubMed |
description | Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC. Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users. Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)]. Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC. |
format | Online Article Text |
id | pubmed-8634684 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-86346842021-12-02 Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up Sardu, Celestino Massetti, Massimo Testa, Nicola Martino, Luigi Di Castellano, Gaetano Turriziani, Fabrizio Sasso, Ferdinando Carlo Torella, Michele De Feo, Marisa Santulli, Gaetano Paolisso, Giuseppe Marfella, Raffaele Front Pharmacol Pharmacology Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC. Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users. Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)]. Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC. Frontiers Media S.A. 2021-11-15 /pmc/articles/PMC8634684/ /pubmed/34867407 http://dx.doi.org/10.3389/fphar.2021.777083 Text en Copyright © 2021 Sardu, Massetti, Testa, Martino, Castellano, Turriziani, Sasso, Torella, De Feo, Santulli, Paolisso and Marfella. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Pharmacology Sardu, Celestino Massetti, Massimo Testa, Nicola Martino, Luigi Di Castellano, Gaetano Turriziani, Fabrizio Sasso, Ferdinando Carlo Torella, Michele De Feo, Marisa Santulli, Gaetano Paolisso, Giuseppe Marfella, Raffaele Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title | Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title_full | Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title_fullStr | Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title_full_unstemmed | Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title_short | Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up |
title_sort | effects of sodium-glucose transporter 2 inhibitors (sglt2-i) in patients with ischemic heart disease (ihd) treated by coronary artery bypass grafting via miecc: inflammatory burden, and clinical outcomes at 5 years of follow-up |
topic | Pharmacology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8634684/ https://www.ncbi.nlm.nih.gov/pubmed/34867407 http://dx.doi.org/10.3389/fphar.2021.777083 |
work_keys_str_mv | AT sarducelestino effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT massettimassimo effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT testanicola effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT martinoluigidi effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT castellanogaetano effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT turrizianifabrizio effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT sassoferdinandocarlo effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT torellamichele effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT defeomarisa effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT santulligaetano effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT paolissogiuseppe effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup AT marfellaraffaele effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup |