Cargando…

Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up

Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a...

Descripción completa

Detalles Bibliográficos
Autores principales: Sardu, Celestino, Massetti, Massimo, Testa, Nicola, Martino, Luigi Di, Castellano, Gaetano, Turriziani, Fabrizio, Sasso, Ferdinando Carlo, Torella, Michele, De Feo, Marisa, Santulli, Gaetano, Paolisso, Giuseppe, Marfella, Raffaele
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8634684/
https://www.ncbi.nlm.nih.gov/pubmed/34867407
http://dx.doi.org/10.3389/fphar.2021.777083
_version_ 1784608171303632896
author Sardu, Celestino
Massetti, Massimo
Testa, Nicola
Martino, Luigi Di
Castellano, Gaetano
Turriziani, Fabrizio
Sasso, Ferdinando Carlo
Torella, Michele
De Feo, Marisa
Santulli, Gaetano
Paolisso, Giuseppe
Marfella, Raffaele
author_facet Sardu, Celestino
Massetti, Massimo
Testa, Nicola
Martino, Luigi Di
Castellano, Gaetano
Turriziani, Fabrizio
Sasso, Ferdinando Carlo
Torella, Michele
De Feo, Marisa
Santulli, Gaetano
Paolisso, Giuseppe
Marfella, Raffaele
author_sort Sardu, Celestino
collection PubMed
description Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC. Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users. Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)]. Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC.
format Online
Article
Text
id pubmed-8634684
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-86346842021-12-02 Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up Sardu, Celestino Massetti, Massimo Testa, Nicola Martino, Luigi Di Castellano, Gaetano Turriziani, Fabrizio Sasso, Ferdinando Carlo Torella, Michele De Feo, Marisa Santulli, Gaetano Paolisso, Giuseppe Marfella, Raffaele Front Pharmacol Pharmacology Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC. Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users. Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)]. Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC. Frontiers Media S.A. 2021-11-15 /pmc/articles/PMC8634684/ /pubmed/34867407 http://dx.doi.org/10.3389/fphar.2021.777083 Text en Copyright © 2021 Sardu, Massetti, Testa, Martino, Castellano, Turriziani, Sasso, Torella, De Feo, Santulli, Paolisso and Marfella. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Pharmacology
Sardu, Celestino
Massetti, Massimo
Testa, Nicola
Martino, Luigi Di
Castellano, Gaetano
Turriziani, Fabrizio
Sasso, Ferdinando Carlo
Torella, Michele
De Feo, Marisa
Santulli, Gaetano
Paolisso, Giuseppe
Marfella, Raffaele
Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_full Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_fullStr Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_full_unstemmed Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_short Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_sort effects of sodium-glucose transporter 2 inhibitors (sglt2-i) in patients with ischemic heart disease (ihd) treated by coronary artery bypass grafting via miecc: inflammatory burden, and clinical outcomes at 5 years of follow-up
topic Pharmacology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8634684/
https://www.ncbi.nlm.nih.gov/pubmed/34867407
http://dx.doi.org/10.3389/fphar.2021.777083
work_keys_str_mv AT sarducelestino effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT massettimassimo effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT testanicola effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT martinoluigidi effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT castellanogaetano effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT turrizianifabrizio effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT sassoferdinandocarlo effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT torellamichele effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT defeomarisa effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT santulligaetano effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT paolissogiuseppe effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT marfellaraffaele effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup