Cargando…
Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis
BACKGROUND: Improving health system efficiency is a key strategy to increase health system performance and accelerate progress towards Universal Health Coverage. In 2013, Kenya transitioned into a devolved system of government granting county governments autonomy over budgets and priorities. We asse...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8647450/ https://www.ncbi.nlm.nih.gov/pubmed/34872560 http://dx.doi.org/10.1186/s12962-021-00332-1 |
_version_ | 1784610606996783104 |
---|---|
author | Barasa, Edwine Musiega, Anita Hanson, Kara Nyawira, Lizah Mulwa, Andrew Molyneux, Sassy Maina, Isabel Tsofa, Benjamin Normand, Charles Jemutai, Julie |
author_facet | Barasa, Edwine Musiega, Anita Hanson, Kara Nyawira, Lizah Mulwa, Andrew Molyneux, Sassy Maina, Isabel Tsofa, Benjamin Normand, Charles Jemutai, Julie |
author_sort | Barasa, Edwine |
collection | PubMed |
description | BACKGROUND: Improving health system efficiency is a key strategy to increase health system performance and accelerate progress towards Universal Health Coverage. In 2013, Kenya transitioned into a devolved system of government granting county governments autonomy over budgets and priorities. We assessed the level and determinants of technical efficiency of the 47 county health systems in Kenya. METHODS: We carried out a two-stage data envelopment analysis (DEA) using Simar and Wilson’s double bootstrap method using data from all the 47 counties in Kenya. In the first stage, we derived the bootstrapped DEA scores using an output orientation. We used three input variables (Public county health expenditure, Private county health expenditure, number of healthcare facilities), and one outcome variable (Disability Adjusted Life Years) using 2018 data. In the second stage, the bias corrected technical inefficiency scores were regressed against 14 exogenous factors using a bootstrapped truncated regression. RESULTS: The mean bias-corrected technical efficiency score of the 47 counties was 69.72% (95% CI 66.41–73.01%), indicating that on average, county health systems could increase their outputs by 30.28% at the same level of inputs. County technical efficiency scores ranged from 42.69% (95% CI 38.11–45.26%) to 91.99% (95% CI 83.78–98.95%). Higher HIV prevalence was associated with greater technical inefficiency of county health systems, while higher population density, county absorption of development budgets, and quality of care provided by healthcare facilities were associated with lower county health system inefficiency. CONCLUSIONS: The findings from this analysis highlight the need for county health departments to consider ways to improve the efficiency of county health systems. Approaches could include prioritizing resources to interventions that will reduce high chronic disease burden, filling structural quality gaps, implementing interventions to improve process quality, identifying the challenges to absorption rates and reforming public finance management systems to enhance their efficiency. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12962-021-00332-1. |
format | Online Article Text |
id | pubmed-8647450 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-86474502021-12-07 Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis Barasa, Edwine Musiega, Anita Hanson, Kara Nyawira, Lizah Mulwa, Andrew Molyneux, Sassy Maina, Isabel Tsofa, Benjamin Normand, Charles Jemutai, Julie Cost Eff Resour Alloc Research BACKGROUND: Improving health system efficiency is a key strategy to increase health system performance and accelerate progress towards Universal Health Coverage. In 2013, Kenya transitioned into a devolved system of government granting county governments autonomy over budgets and priorities. We assessed the level and determinants of technical efficiency of the 47 county health systems in Kenya. METHODS: We carried out a two-stage data envelopment analysis (DEA) using Simar and Wilson’s double bootstrap method using data from all the 47 counties in Kenya. In the first stage, we derived the bootstrapped DEA scores using an output orientation. We used three input variables (Public county health expenditure, Private county health expenditure, number of healthcare facilities), and one outcome variable (Disability Adjusted Life Years) using 2018 data. In the second stage, the bias corrected technical inefficiency scores were regressed against 14 exogenous factors using a bootstrapped truncated regression. RESULTS: The mean bias-corrected technical efficiency score of the 47 counties was 69.72% (95% CI 66.41–73.01%), indicating that on average, county health systems could increase their outputs by 30.28% at the same level of inputs. County technical efficiency scores ranged from 42.69% (95% CI 38.11–45.26%) to 91.99% (95% CI 83.78–98.95%). Higher HIV prevalence was associated with greater technical inefficiency of county health systems, while higher population density, county absorption of development budgets, and quality of care provided by healthcare facilities were associated with lower county health system inefficiency. CONCLUSIONS: The findings from this analysis highlight the need for county health departments to consider ways to improve the efficiency of county health systems. Approaches could include prioritizing resources to interventions that will reduce high chronic disease burden, filling structural quality gaps, implementing interventions to improve process quality, identifying the challenges to absorption rates and reforming public finance management systems to enhance their efficiency. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12962-021-00332-1. BioMed Central 2021-12-06 /pmc/articles/PMC8647450/ /pubmed/34872560 http://dx.doi.org/10.1186/s12962-021-00332-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Barasa, Edwine Musiega, Anita Hanson, Kara Nyawira, Lizah Mulwa, Andrew Molyneux, Sassy Maina, Isabel Tsofa, Benjamin Normand, Charles Jemutai, Julie Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title | Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title_full | Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title_fullStr | Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title_full_unstemmed | Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title_short | Level and determinants of county health system technical efficiency in Kenya: two stage data envelopment analysis |
title_sort | level and determinants of county health system technical efficiency in kenya: two stage data envelopment analysis |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8647450/ https://www.ncbi.nlm.nih.gov/pubmed/34872560 http://dx.doi.org/10.1186/s12962-021-00332-1 |
work_keys_str_mv | AT barasaedwine levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT musiegaanita levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT hansonkara levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT nyawiralizah levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT mulwaandrew levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT molyneuxsassy levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT mainaisabel levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT tsofabenjamin levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT normandcharles levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis AT jemutaijulie levelanddeterminantsofcountyhealthsystemtechnicalefficiencyinkenyatwostagedataenvelopmentanalysis |