Cargando…

Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains

Dehydrins (DHNs) are a family of plant proteins that play important roles on abiotic stress tolerance and seed development. They are classified into five structural subgroups: K-, SK-, YK-, YSK-, and KS-DHNs, according to the presence of conserved motifs named K-, Y- and S- segments. We carried out...

Descripción completa

Detalles Bibliográficos
Autores principales: Melgar, Alejandra E., Zelada, Alicia M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8669000/
https://www.ncbi.nlm.nih.gov/pubmed/34903751
http://dx.doi.org/10.1038/s41598-021-03066-5
_version_ 1784614700646924288
author Melgar, Alejandra E.
Zelada, Alicia M.
author_facet Melgar, Alejandra E.
Zelada, Alicia M.
author_sort Melgar, Alejandra E.
collection PubMed
description Dehydrins (DHNs) are a family of plant proteins that play important roles on abiotic stress tolerance and seed development. They are classified into five structural subgroups: K-, SK-, YK-, YSK-, and KS-DHNs, according to the presence of conserved motifs named K-, Y- and S- segments. We carried out a comparative structural and phylogenetic analysis of these proteins, focusing on the less-studied KS-type DHNs. A search for conserved motifs in DHNs from 56 plant genomes revealed that KS-DHNs possess a unique and highly conserved N-terminal, 15-residue amino acid motif, not previously described. This novel motif, that we named H-segment, is present in DHNs of angiosperms, gymnosperms and lycophytes, suggesting that HKS-DHNs were present in the first vascular plants. Phylogenetic and microsynteny analyses indicate that the five structural subgroups of angiosperm DHNs can be assigned to three groups of orthologue genes, characterized by the presence of the H-, F- or Y- segments. Importantly, the hydrophilin character of DHNs correlate with the phylogenetic origin of the DHNs rather than to the traditional structural subgroups. We propose that angiosperm DHNs can be ultimately subdivided into three orthologous groups, a phylogenetic framework that should help future studies on the evolution and function of this protein family.
format Online
Article
Text
id pubmed-8669000
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-86690002021-12-15 Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains Melgar, Alejandra E. Zelada, Alicia M. Sci Rep Article Dehydrins (DHNs) are a family of plant proteins that play important roles on abiotic stress tolerance and seed development. They are classified into five structural subgroups: K-, SK-, YK-, YSK-, and KS-DHNs, according to the presence of conserved motifs named K-, Y- and S- segments. We carried out a comparative structural and phylogenetic analysis of these proteins, focusing on the less-studied KS-type DHNs. A search for conserved motifs in DHNs from 56 plant genomes revealed that KS-DHNs possess a unique and highly conserved N-terminal, 15-residue amino acid motif, not previously described. This novel motif, that we named H-segment, is present in DHNs of angiosperms, gymnosperms and lycophytes, suggesting that HKS-DHNs were present in the first vascular plants. Phylogenetic and microsynteny analyses indicate that the five structural subgroups of angiosperm DHNs can be assigned to three groups of orthologue genes, characterized by the presence of the H-, F- or Y- segments. Importantly, the hydrophilin character of DHNs correlate with the phylogenetic origin of the DHNs rather than to the traditional structural subgroups. We propose that angiosperm DHNs can be ultimately subdivided into three orthologous groups, a phylogenetic framework that should help future studies on the evolution and function of this protein family. Nature Publishing Group UK 2021-12-13 /pmc/articles/PMC8669000/ /pubmed/34903751 http://dx.doi.org/10.1038/s41598-021-03066-5 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Melgar, Alejandra E.
Zelada, Alicia M.
Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title_full Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title_fullStr Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title_full_unstemmed Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title_short Evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
title_sort evolutionary analysis of angiosperm dehydrin gene family reveals three orthologues groups associated to specific protein domains
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8669000/
https://www.ncbi.nlm.nih.gov/pubmed/34903751
http://dx.doi.org/10.1038/s41598-021-03066-5
work_keys_str_mv AT melgaralejandrae evolutionaryanalysisofangiospermdehydringenefamilyrevealsthreeorthologuesgroupsassociatedtospecificproteindomains
AT zeladaaliciam evolutionaryanalysisofangiospermdehydringenefamilyrevealsthreeorthologuesgroupsassociatedtospecificproteindomains