Cargando…
Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii
Coffee berry borer (CBB, Hypothenemus hampei Ferrari) is the most serious insect pest of coffee worldwide, yet little is known about the effect that weather variables have on CBB flight activity. We sampled flying female CBB adults bi-weekly over a three-year period using red funnel traps baited wit...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8687535/ https://www.ncbi.nlm.nih.gov/pubmed/34928953 http://dx.doi.org/10.1371/journal.pone.0257861 |
_version_ | 1784618191473868800 |
---|---|
author | Johnson, Melissa A. Manoukis, Nicholas C. |
author_facet | Johnson, Melissa A. Manoukis, Nicholas C. |
author_sort | Johnson, Melissa A. |
collection | PubMed |
description | Coffee berry borer (CBB, Hypothenemus hampei Ferrari) is the most serious insect pest of coffee worldwide, yet little is known about the effect that weather variables have on CBB flight activity. We sampled flying female CBB adults bi-weekly over a three-year period using red funnel traps baited with an alcohol lure at 14 commercial coffee farms on Hawaii Island to characterize seasonal phenology and the relationship between flight activity and five weather variables. We captured almost 5 million scolytid beetles during the sampling period, with 81–93% of the trap catch comprised of CBB. Of the captured non-target beetles, the majority were tropical nut borer, black twig borer and a species of Cryphalus. Two major flight events were consistent across all three years: an initial emergence from January-April that coincided with early fruit development and a second flight during the harvest season from September-December. A generalized additive mixed model (GAMM) revealed that mean daily air temperature had a highly significant positive correlation with CBB flight; most flight events occurred between 20–26°C. Mean daily solar radiation also had a significant positive relationship with flight. Flight was positively correlated with maximum daily relative humidity at values below ~94%, and cumulative rainfall up to 100 mm; flight was also positively correlated with maximum daily wind speeds up to ~2.5 m/s, after which activity declined. Our findings provide important insight into CBB flight patterns across a highly variable landscape and can serve as a starting point for the development of flight prediction models. |
format | Online Article Text |
id | pubmed-8687535 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-86875352021-12-21 Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii Johnson, Melissa A. Manoukis, Nicholas C. PLoS One Research Article Coffee berry borer (CBB, Hypothenemus hampei Ferrari) is the most serious insect pest of coffee worldwide, yet little is known about the effect that weather variables have on CBB flight activity. We sampled flying female CBB adults bi-weekly over a three-year period using red funnel traps baited with an alcohol lure at 14 commercial coffee farms on Hawaii Island to characterize seasonal phenology and the relationship between flight activity and five weather variables. We captured almost 5 million scolytid beetles during the sampling period, with 81–93% of the trap catch comprised of CBB. Of the captured non-target beetles, the majority were tropical nut borer, black twig borer and a species of Cryphalus. Two major flight events were consistent across all three years: an initial emergence from January-April that coincided with early fruit development and a second flight during the harvest season from September-December. A generalized additive mixed model (GAMM) revealed that mean daily air temperature had a highly significant positive correlation with CBB flight; most flight events occurred between 20–26°C. Mean daily solar radiation also had a significant positive relationship with flight. Flight was positively correlated with maximum daily relative humidity at values below ~94%, and cumulative rainfall up to 100 mm; flight was also positively correlated with maximum daily wind speeds up to ~2.5 m/s, after which activity declined. Our findings provide important insight into CBB flight patterns across a highly variable landscape and can serve as a starting point for the development of flight prediction models. Public Library of Science 2021-12-20 /pmc/articles/PMC8687535/ /pubmed/34928953 http://dx.doi.org/10.1371/journal.pone.0257861 Text en https://creativecommons.org/publicdomain/zero/1.0/This is an open access article, free of all copyright, and may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. The work is made available under the Creative Commons CC0 (https://creativecommons.org/publicdomain/zero/1.0/) public domain dedication. |
spellingShingle | Research Article Johnson, Melissa A. Manoukis, Nicholas C. Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title | Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title_full | Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title_fullStr | Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title_full_unstemmed | Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title_short | Influence of seasonal and climatic variables on coffee berry borer (Hypothenemus hampei Ferrari) flight activity in Hawaii |
title_sort | influence of seasonal and climatic variables on coffee berry borer (hypothenemus hampei ferrari) flight activity in hawaii |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8687535/ https://www.ncbi.nlm.nih.gov/pubmed/34928953 http://dx.doi.org/10.1371/journal.pone.0257861 |
work_keys_str_mv | AT johnsonmelissaa influenceofseasonalandclimaticvariablesoncoffeeberryborerhypothenemushampeiferrariflightactivityinhawaii AT manoukisnicholasc influenceofseasonalandclimaticvariablesoncoffeeberryborerhypothenemushampeiferrariflightactivityinhawaii |