Cargando…
Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Lippincott Williams & Wilkins
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8702007/ https://www.ncbi.nlm.nih.gov/pubmed/34941060 http://dx.doi.org/10.1097/MD.0000000000028141 |
_version_ | 1784621142282076160 |
---|---|
author | Luan, Huiyan Zhang, Lei Zhang, Sijin Zhang, Meng |
author_facet | Luan, Huiyan Zhang, Lei Zhang, Sijin Zhang, Meng |
author_sort | Luan, Huiyan |
collection | PubMed |
description | RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1 (FHM1). PATIENT CONCERNS: A Chinese girl and some of her relatives who presented with hemiplegia with or without migraine were found to carry a novel heterozygous missense variant, I1379F, in CACNA1A by whole-exome sequencing. The variant consegregated with the disease and was predicted to be pathogenic. DIAGNOSIS: The patient was diagnosed with FHM1 clinically and genetically. INTERVENTIONS: Prophylactic therapy with flunarizine 5 mg daily was prescribed to the patient. OUTCOMES: Therapy with flunarizine was terminated after a few weeks. The intensity of the attacks was the same as before. LESSONS: This case indicates that FHM should be considered when a patient manifests with episodic hemiplegia without migraine. In addition, genetic testing is an indispensable method to identify atypical attacks of hemiplegic migraine. |
format | Online Article Text |
id | pubmed-8702007 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Lippincott Williams & Wilkins |
record_format | MEDLINE/PubMed |
spelling | pubmed-87020072021-12-27 Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report Luan, Huiyan Zhang, Lei Zhang, Sijin Zhang, Meng Medicine (Baltimore) 5300 RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1 (FHM1). PATIENT CONCERNS: A Chinese girl and some of her relatives who presented with hemiplegia with or without migraine were found to carry a novel heterozygous missense variant, I1379F, in CACNA1A by whole-exome sequencing. The variant consegregated with the disease and was predicted to be pathogenic. DIAGNOSIS: The patient was diagnosed with FHM1 clinically and genetically. INTERVENTIONS: Prophylactic therapy with flunarizine 5 mg daily was prescribed to the patient. OUTCOMES: Therapy with flunarizine was terminated after a few weeks. The intensity of the attacks was the same as before. LESSONS: This case indicates that FHM should be considered when a patient manifests with episodic hemiplegia without migraine. In addition, genetic testing is an indispensable method to identify atypical attacks of hemiplegic migraine. Lippincott Williams & Wilkins 2021-12-23 /pmc/articles/PMC8702007/ /pubmed/34941060 http://dx.doi.org/10.1097/MD.0000000000028141 Text en Copyright © 2021 the Author(s). Published by Wolters Kluwer Health, Inc. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 (https://creativecommons.org/licenses/by/4.0/) |
spellingShingle | 5300 Luan, Huiyan Zhang, Lei Zhang, Sijin Zhang, Meng Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title | Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title_full | Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title_fullStr | Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title_full_unstemmed | Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title_short | Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report |
title_sort | next-generation sequencing identified a novel cacna1a i1379f variant in a familial hemiplegic migraine type 1 pedigree: a case report |
topic | 5300 |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8702007/ https://www.ncbi.nlm.nih.gov/pubmed/34941060 http://dx.doi.org/10.1097/MD.0000000000028141 |
work_keys_str_mv | AT luanhuiyan nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport AT zhanglei nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport AT zhangsijin nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport AT zhangmeng nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport |