Cargando…

Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report

RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1...

Descripción completa

Detalles Bibliográficos
Autores principales: Luan, Huiyan, Zhang, Lei, Zhang, Sijin, Zhang, Meng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Lippincott Williams & Wilkins 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8702007/
https://www.ncbi.nlm.nih.gov/pubmed/34941060
http://dx.doi.org/10.1097/MD.0000000000028141
_version_ 1784621142282076160
author Luan, Huiyan
Zhang, Lei
Zhang, Sijin
Zhang, Meng
author_facet Luan, Huiyan
Zhang, Lei
Zhang, Sijin
Zhang, Meng
author_sort Luan, Huiyan
collection PubMed
description RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1 (FHM1). PATIENT CONCERNS: A Chinese girl and some of her relatives who presented with hemiplegia with or without migraine were found to carry a novel heterozygous missense variant, I1379F, in CACNA1A by whole-exome sequencing. The variant consegregated with the disease and was predicted to be pathogenic. DIAGNOSIS: The patient was diagnosed with FHM1 clinically and genetically. INTERVENTIONS: Prophylactic therapy with flunarizine 5 mg daily was prescribed to the patient. OUTCOMES: Therapy with flunarizine was terminated after a few weeks. The intensity of the attacks was the same as before. LESSONS: This case indicates that FHM should be considered when a patient manifests with episodic hemiplegia without migraine. In addition, genetic testing is an indispensable method to identify atypical attacks of hemiplegic migraine.
format Online
Article
Text
id pubmed-8702007
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Lippincott Williams & Wilkins
record_format MEDLINE/PubMed
spelling pubmed-87020072021-12-27 Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report Luan, Huiyan Zhang, Lei Zhang, Sijin Zhang, Meng Medicine (Baltimore) 5300 RATIONALE: Familial hemiplegic migraine (FHM) is a rare, autosomal dominant migraine with aura. CACNA1A encodes the α1A subunit of P/Q-type voltage-gated calcium channels, and its mutations have been associated with a wide spectrum of episodic and chronic neurological disorders, including FHM type 1 (FHM1). PATIENT CONCERNS: A Chinese girl and some of her relatives who presented with hemiplegia with or without migraine were found to carry a novel heterozygous missense variant, I1379F, in CACNA1A by whole-exome sequencing. The variant consegregated with the disease and was predicted to be pathogenic. DIAGNOSIS: The patient was diagnosed with FHM1 clinically and genetically. INTERVENTIONS: Prophylactic therapy with flunarizine 5 mg daily was prescribed to the patient. OUTCOMES: Therapy with flunarizine was terminated after a few weeks. The intensity of the attacks was the same as before. LESSONS: This case indicates that FHM should be considered when a patient manifests with episodic hemiplegia without migraine. In addition, genetic testing is an indispensable method to identify atypical attacks of hemiplegic migraine. Lippincott Williams & Wilkins 2021-12-23 /pmc/articles/PMC8702007/ /pubmed/34941060 http://dx.doi.org/10.1097/MD.0000000000028141 Text en Copyright © 2021 the Author(s). Published by Wolters Kluwer Health, Inc. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 (https://creativecommons.org/licenses/by/4.0/)
spellingShingle 5300
Luan, Huiyan
Zhang, Lei
Zhang, Sijin
Zhang, Meng
Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title_full Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title_fullStr Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title_full_unstemmed Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title_short Next-generation sequencing identified a novel CACNA1A I1379F variant in a familial hemiplegic migraine type 1 pedigree: A case report
title_sort next-generation sequencing identified a novel cacna1a i1379f variant in a familial hemiplegic migraine type 1 pedigree: a case report
topic 5300
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8702007/
https://www.ncbi.nlm.nih.gov/pubmed/34941060
http://dx.doi.org/10.1097/MD.0000000000028141
work_keys_str_mv AT luanhuiyan nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport
AT zhanglei nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport
AT zhangsijin nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport
AT zhangmeng nextgenerationsequencingidentifiedanovelcacna1ai1379fvariantinafamilialhemiplegicmigrainetype1pedigreeacasereport