Cargando…
The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review
BACKGROUND: Microbial biofilm accumulation is the main cause of peri-implantitis. The majority of surgical peri-implantitis treatment protocols suggests adjunctive use of systemic antibiotics to target specific putative bacteria. The aim of this systematic review was to critically evaluate the adjun...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8711198/ https://www.ncbi.nlm.nih.gov/pubmed/34961495 http://dx.doi.org/10.1186/s12903-021-02020-1 |
_version_ | 1784623322961543168 |
---|---|
author | Øen, Malene Leknes, Knut N. Lund, Bodil Bunæs, Dagmar F. |
author_facet | Øen, Malene Leknes, Knut N. Lund, Bodil Bunæs, Dagmar F. |
author_sort | Øen, Malene |
collection | PubMed |
description | BACKGROUND: Microbial biofilm accumulation is the main cause of peri-implantitis. The majority of surgical peri-implantitis treatment protocols suggests adjunctive use of systemic antibiotics to target specific putative bacteria. The aim of this systematic review was to critically evaluate the adjunctive use of systemically administered antibiotics in surgical treatment of peri-implantitis by reviewing previously published systematic reviews and primary studies. METHODS: A systematic literature search was conducted in four electronic databases (MEDLINE, The Cochrane Library, EMBASE, and Web of Science) for randomised controlled trials, cohort studies, case–control studies, and systematic reviews reporting surgical treatment of peri-implantitis with and without adjunctive systemically administered antibiotic therapy. The included systematic reviews and primary studies were qualitatively assessed using AMSTAR and GRADE, respectively. No restrictions were set for date of publication, journal, or language. RESULTS: The literature search identified 681 papers. Only seven systematic reviews and two primary studies met the inclusion criteria. Four out of seven included systematic reviews concluded that no evidence exists for use of systemic antibiotics to improve the clinical outcomes in surgical treatment of peri-implantitis. One review did not estimate the level of evidence, one did not clearly state any beneficial effect, whereas one reported a limited adjunctive effect. Further, the two included primary studies did not show a long-term significant benefit of adjunctive use of systemically administrated antibiotics. However, one study reported a short-term adjunctive effect in patients with modified surface implants. Due to heterogeneity in study design, low number of included primary studies, and grade of bias, no meta-analysis was performed. CONCLUSION: The use of systemically administered antibiotics as an adjunct to surgical interventions of peri-implantitis cannot be justified as a part of a standard treatment protocol. A pervasive problem is the lack of uniform diagnosis criteria for peri-implantitis, deficient information about patient characteristics, absence of high quality long-term randomised controlled trials, and authors’ declaration on conflict of interest. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-021-02020-1. |
format | Online Article Text |
id | pubmed-8711198 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-87111982022-01-05 The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review Øen, Malene Leknes, Knut N. Lund, Bodil Bunæs, Dagmar F. BMC Oral Health Research BACKGROUND: Microbial biofilm accumulation is the main cause of peri-implantitis. The majority of surgical peri-implantitis treatment protocols suggests adjunctive use of systemic antibiotics to target specific putative bacteria. The aim of this systematic review was to critically evaluate the adjunctive use of systemically administered antibiotics in surgical treatment of peri-implantitis by reviewing previously published systematic reviews and primary studies. METHODS: A systematic literature search was conducted in four electronic databases (MEDLINE, The Cochrane Library, EMBASE, and Web of Science) for randomised controlled trials, cohort studies, case–control studies, and systematic reviews reporting surgical treatment of peri-implantitis with and without adjunctive systemically administered antibiotic therapy. The included systematic reviews and primary studies were qualitatively assessed using AMSTAR and GRADE, respectively. No restrictions were set for date of publication, journal, or language. RESULTS: The literature search identified 681 papers. Only seven systematic reviews and two primary studies met the inclusion criteria. Four out of seven included systematic reviews concluded that no evidence exists for use of systemic antibiotics to improve the clinical outcomes in surgical treatment of peri-implantitis. One review did not estimate the level of evidence, one did not clearly state any beneficial effect, whereas one reported a limited adjunctive effect. Further, the two included primary studies did not show a long-term significant benefit of adjunctive use of systemically administrated antibiotics. However, one study reported a short-term adjunctive effect in patients with modified surface implants. Due to heterogeneity in study design, low number of included primary studies, and grade of bias, no meta-analysis was performed. CONCLUSION: The use of systemically administered antibiotics as an adjunct to surgical interventions of peri-implantitis cannot be justified as a part of a standard treatment protocol. A pervasive problem is the lack of uniform diagnosis criteria for peri-implantitis, deficient information about patient characteristics, absence of high quality long-term randomised controlled trials, and authors’ declaration on conflict of interest. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-021-02020-1. BioMed Central 2021-12-27 /pmc/articles/PMC8711198/ /pubmed/34961495 http://dx.doi.org/10.1186/s12903-021-02020-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Øen, Malene Leknes, Knut N. Lund, Bodil Bunæs, Dagmar F. The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title | The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title_full | The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title_fullStr | The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title_full_unstemmed | The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title_short | The efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
title_sort | efficacy of systemic antibiotics as an adjunct to surgical treatment of peri-implantitis: a systematic review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8711198/ https://www.ncbi.nlm.nih.gov/pubmed/34961495 http://dx.doi.org/10.1186/s12903-021-02020-1 |
work_keys_str_mv | AT øenmalene theefficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT leknesknutn theefficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT lundbodil theefficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT bunæsdagmarf theefficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT øenmalene efficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT leknesknutn efficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT lundbodil efficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview AT bunæsdagmarf efficacyofsystemicantibioticsasanadjuncttosurgicaltreatmentofperiimplantitisasystematicreview |