Cargando…

B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization

Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could...

Descripción completa

Detalles Bibliográficos
Autores principales: Cucchiari, David, Tubita, Valeria, Rovira, Jordi, Ramirez-Bajo, Maria J., Banon-Maneus, Elisenda, Lazo-Rodriguez, Marta, Hierro-Garcia, Natalia, Borràs, Francesc E., Ventura-Aguiar, Pedro, Piñeiro, Gastón J., Martorell, Jaume, Peri, Lluís, Musquera, Mireia, Hertig, Alexandre, Oppenheimer, Federico, Campistol, Josep M., Diekmann, Fritz, Revuelta, Ignacio
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8716735/
https://www.ncbi.nlm.nih.gov/pubmed/34977082
http://dx.doi.org/10.3389/fmed.2021.781239
_version_ 1784624380438904832
author Cucchiari, David
Tubita, Valeria
Rovira, Jordi
Ramirez-Bajo, Maria J.
Banon-Maneus, Elisenda
Lazo-Rodriguez, Marta
Hierro-Garcia, Natalia
Borràs, Francesc E.
Ventura-Aguiar, Pedro
Piñeiro, Gastón J.
Martorell, Jaume
Peri, Lluís
Musquera, Mireia
Hertig, Alexandre
Oppenheimer, Federico
Campistol, Josep M.
Diekmann, Fritz
Revuelta, Ignacio
author_facet Cucchiari, David
Tubita, Valeria
Rovira, Jordi
Ramirez-Bajo, Maria J.
Banon-Maneus, Elisenda
Lazo-Rodriguez, Marta
Hierro-Garcia, Natalia
Borràs, Francesc E.
Ventura-Aguiar, Pedro
Piñeiro, Gastón J.
Martorell, Jaume
Peri, Lluís
Musquera, Mireia
Hertig, Alexandre
Oppenheimer, Federico
Campistol, Josep M.
Diekmann, Fritz
Revuelta, Ignacio
author_sort Cucchiari, David
collection PubMed
description Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could be estimated by the presence of circulating B cell-derived extracellular vesicles (BEVs). Methods: BEVs were isolated by Sepharose-based size exclusion chromatography and defined as CD19+ and HLA-II+ extracellular vesicles. We analyzed stored serum samples from positive crossmatch LDKT recipients before and after desensitization at first post-transplant biopsy and at 12-month protocol biopsy (n = 11). Control groups were formed by hypersensitized patients who were not submitted to desensitization (n = 10) and by low-risk recipients (n = 9). A prospective validation cohort of 11 patients also included the analysis of B cells subpopulations in recipients' blood and lymph nodes recovered upon graft implantation, along with BEVs analysis before and after desensitization. Results: We found out that CD19+ and HLA-II+BEVs dropped significantly after desensitization and relapse in patients who later developed ABMR was evident. We validated these findings in a proof-of-concept prospective cohort of 6 patients who received the same desensitization protocol and also in a control group of 5 LDKT recipients. In these patients, B cell subpopulations were also studied in recipients' blood and lymph nodes that were recovered before the graft implantation. We confirmed the significant drop in BEVs after desensitization and that this paralleled the reduction in CD19+cells in lymph nodes, while in peripheral blood B cells, this change was almost undetectable. Conclusions: BEVs reflected B cell residual activity after desensitization and this could be a valid surrogate of humoral alloreactivity in this setting.
format Online
Article
Text
id pubmed-8716735
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-87167352021-12-31 B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization Cucchiari, David Tubita, Valeria Rovira, Jordi Ramirez-Bajo, Maria J. Banon-Maneus, Elisenda Lazo-Rodriguez, Marta Hierro-Garcia, Natalia Borràs, Francesc E. Ventura-Aguiar, Pedro Piñeiro, Gastón J. Martorell, Jaume Peri, Lluís Musquera, Mireia Hertig, Alexandre Oppenheimer, Federico Campistol, Josep M. Diekmann, Fritz Revuelta, Ignacio Front Med (Lausanne) Medicine Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could be estimated by the presence of circulating B cell-derived extracellular vesicles (BEVs). Methods: BEVs were isolated by Sepharose-based size exclusion chromatography and defined as CD19+ and HLA-II+ extracellular vesicles. We analyzed stored serum samples from positive crossmatch LDKT recipients before and after desensitization at first post-transplant biopsy and at 12-month protocol biopsy (n = 11). Control groups were formed by hypersensitized patients who were not submitted to desensitization (n = 10) and by low-risk recipients (n = 9). A prospective validation cohort of 11 patients also included the analysis of B cells subpopulations in recipients' blood and lymph nodes recovered upon graft implantation, along with BEVs analysis before and after desensitization. Results: We found out that CD19+ and HLA-II+BEVs dropped significantly after desensitization and relapse in patients who later developed ABMR was evident. We validated these findings in a proof-of-concept prospective cohort of 6 patients who received the same desensitization protocol and also in a control group of 5 LDKT recipients. In these patients, B cell subpopulations were also studied in recipients' blood and lymph nodes that were recovered before the graft implantation. We confirmed the significant drop in BEVs after desensitization and that this paralleled the reduction in CD19+cells in lymph nodes, while in peripheral blood B cells, this change was almost undetectable. Conclusions: BEVs reflected B cell residual activity after desensitization and this could be a valid surrogate of humoral alloreactivity in this setting. Frontiers Media S.A. 2021-12-16 /pmc/articles/PMC8716735/ /pubmed/34977082 http://dx.doi.org/10.3389/fmed.2021.781239 Text en Copyright © 2021 Cucchiari, Tubita, Rovira, Ramirez-Bajo, Banon-Maneus, Lazo-Rodriguez, Hierro-Garcia, Borràs, Ventura-Aguiar, Piñeiro, Martorell, Peri, Musquera, Hertig, Oppenheimer, Campistol, Diekmann and Revuelta. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Medicine
Cucchiari, David
Tubita, Valeria
Rovira, Jordi
Ramirez-Bajo, Maria J.
Banon-Maneus, Elisenda
Lazo-Rodriguez, Marta
Hierro-Garcia, Natalia
Borràs, Francesc E.
Ventura-Aguiar, Pedro
Piñeiro, Gastón J.
Martorell, Jaume
Peri, Lluís
Musquera, Mireia
Hertig, Alexandre
Oppenheimer, Federico
Campistol, Josep M.
Diekmann, Fritz
Revuelta, Ignacio
B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title_full B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title_fullStr B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title_full_unstemmed B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title_short B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
title_sort b cell-derived extracellular vesicles reveal residual b cell activity in kidney graft recipients undergoing pre-transplant desensitization
topic Medicine
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8716735/
https://www.ncbi.nlm.nih.gov/pubmed/34977082
http://dx.doi.org/10.3389/fmed.2021.781239
work_keys_str_mv AT cucchiaridavid bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT tubitavaleria bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT rovirajordi bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT ramirezbajomariaj bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT banonmaneuselisenda bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT lazorodriguezmarta bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT hierrogarcianatalia bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT borrasfrancesce bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT venturaaguiarpedro bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT pineirogastonj bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT martorelljaume bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT perilluis bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT musqueramireia bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT hertigalexandre bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT oppenheimerfederico bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT campistoljosepm bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT diekmannfritz bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization
AT revueltaignacio bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization