Cargando…
B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization
Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could...
Autores principales: | , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8716735/ https://www.ncbi.nlm.nih.gov/pubmed/34977082 http://dx.doi.org/10.3389/fmed.2021.781239 |
_version_ | 1784624380438904832 |
---|---|
author | Cucchiari, David Tubita, Valeria Rovira, Jordi Ramirez-Bajo, Maria J. Banon-Maneus, Elisenda Lazo-Rodriguez, Marta Hierro-Garcia, Natalia Borràs, Francesc E. Ventura-Aguiar, Pedro Piñeiro, Gastón J. Martorell, Jaume Peri, Lluís Musquera, Mireia Hertig, Alexandre Oppenheimer, Federico Campistol, Josep M. Diekmann, Fritz Revuelta, Ignacio |
author_facet | Cucchiari, David Tubita, Valeria Rovira, Jordi Ramirez-Bajo, Maria J. Banon-Maneus, Elisenda Lazo-Rodriguez, Marta Hierro-Garcia, Natalia Borràs, Francesc E. Ventura-Aguiar, Pedro Piñeiro, Gastón J. Martorell, Jaume Peri, Lluís Musquera, Mireia Hertig, Alexandre Oppenheimer, Federico Campistol, Josep M. Diekmann, Fritz Revuelta, Ignacio |
author_sort | Cucchiari, David |
collection | PubMed |
description | Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could be estimated by the presence of circulating B cell-derived extracellular vesicles (BEVs). Methods: BEVs were isolated by Sepharose-based size exclusion chromatography and defined as CD19+ and HLA-II+ extracellular vesicles. We analyzed stored serum samples from positive crossmatch LDKT recipients before and after desensitization at first post-transplant biopsy and at 12-month protocol biopsy (n = 11). Control groups were formed by hypersensitized patients who were not submitted to desensitization (n = 10) and by low-risk recipients (n = 9). A prospective validation cohort of 11 patients also included the analysis of B cells subpopulations in recipients' blood and lymph nodes recovered upon graft implantation, along with BEVs analysis before and after desensitization. Results: We found out that CD19+ and HLA-II+BEVs dropped significantly after desensitization and relapse in patients who later developed ABMR was evident. We validated these findings in a proof-of-concept prospective cohort of 6 patients who received the same desensitization protocol and also in a control group of 5 LDKT recipients. In these patients, B cell subpopulations were also studied in recipients' blood and lymph nodes that were recovered before the graft implantation. We confirmed the significant drop in BEVs after desensitization and that this paralleled the reduction in CD19+cells in lymph nodes, while in peripheral blood B cells, this change was almost undetectable. Conclusions: BEVs reflected B cell residual activity after desensitization and this could be a valid surrogate of humoral alloreactivity in this setting. |
format | Online Article Text |
id | pubmed-8716735 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-87167352021-12-31 B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization Cucchiari, David Tubita, Valeria Rovira, Jordi Ramirez-Bajo, Maria J. Banon-Maneus, Elisenda Lazo-Rodriguez, Marta Hierro-Garcia, Natalia Borràs, Francesc E. Ventura-Aguiar, Pedro Piñeiro, Gastón J. Martorell, Jaume Peri, Lluís Musquera, Mireia Hertig, Alexandre Oppenheimer, Federico Campistol, Josep M. Diekmann, Fritz Revuelta, Ignacio Front Med (Lausanne) Medicine Background: Living-donor kidney transplant (LDKT) recipients undergoing desensitization for Human Leukocyte Antigen (HLA)-incompatibility have a high risk of developing antibody-mediated rejection (ABMR). The purpose of the study is to evaluate if residual B cell activity after desensitization could be estimated by the presence of circulating B cell-derived extracellular vesicles (BEVs). Methods: BEVs were isolated by Sepharose-based size exclusion chromatography and defined as CD19+ and HLA-II+ extracellular vesicles. We analyzed stored serum samples from positive crossmatch LDKT recipients before and after desensitization at first post-transplant biopsy and at 12-month protocol biopsy (n = 11). Control groups were formed by hypersensitized patients who were not submitted to desensitization (n = 10) and by low-risk recipients (n = 9). A prospective validation cohort of 11 patients also included the analysis of B cells subpopulations in recipients' blood and lymph nodes recovered upon graft implantation, along with BEVs analysis before and after desensitization. Results: We found out that CD19+ and HLA-II+BEVs dropped significantly after desensitization and relapse in patients who later developed ABMR was evident. We validated these findings in a proof-of-concept prospective cohort of 6 patients who received the same desensitization protocol and also in a control group of 5 LDKT recipients. In these patients, B cell subpopulations were also studied in recipients' blood and lymph nodes that were recovered before the graft implantation. We confirmed the significant drop in BEVs after desensitization and that this paralleled the reduction in CD19+cells in lymph nodes, while in peripheral blood B cells, this change was almost undetectable. Conclusions: BEVs reflected B cell residual activity after desensitization and this could be a valid surrogate of humoral alloreactivity in this setting. Frontiers Media S.A. 2021-12-16 /pmc/articles/PMC8716735/ /pubmed/34977082 http://dx.doi.org/10.3389/fmed.2021.781239 Text en Copyright © 2021 Cucchiari, Tubita, Rovira, Ramirez-Bajo, Banon-Maneus, Lazo-Rodriguez, Hierro-Garcia, Borràs, Ventura-Aguiar, Piñeiro, Martorell, Peri, Musquera, Hertig, Oppenheimer, Campistol, Diekmann and Revuelta. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Medicine Cucchiari, David Tubita, Valeria Rovira, Jordi Ramirez-Bajo, Maria J. Banon-Maneus, Elisenda Lazo-Rodriguez, Marta Hierro-Garcia, Natalia Borràs, Francesc E. Ventura-Aguiar, Pedro Piñeiro, Gastón J. Martorell, Jaume Peri, Lluís Musquera, Mireia Hertig, Alexandre Oppenheimer, Federico Campistol, Josep M. Diekmann, Fritz Revuelta, Ignacio B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title | B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title_full | B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title_fullStr | B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title_full_unstemmed | B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title_short | B Cell-Derived Extracellular Vesicles Reveal Residual B Cell Activity in Kidney Graft Recipients Undergoing Pre-Transplant Desensitization |
title_sort | b cell-derived extracellular vesicles reveal residual b cell activity in kidney graft recipients undergoing pre-transplant desensitization |
topic | Medicine |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8716735/ https://www.ncbi.nlm.nih.gov/pubmed/34977082 http://dx.doi.org/10.3389/fmed.2021.781239 |
work_keys_str_mv | AT cucchiaridavid bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT tubitavaleria bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT rovirajordi bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT ramirezbajomariaj bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT banonmaneuselisenda bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT lazorodriguezmarta bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT hierrogarcianatalia bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT borrasfrancesce bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT venturaaguiarpedro bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT pineirogastonj bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT martorelljaume bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT perilluis bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT musqueramireia bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT hertigalexandre bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT oppenheimerfederico bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT campistoljosepm bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT diekmannfritz bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization AT revueltaignacio bcellderivedextracellularvesiclesrevealresidualbcellactivityinkidneygraftrecipientsundergoingpretransplantdesensitization |