Cargando…
Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study
BACKGROUND: The relationships of healthy lifestyle scores (HLS) of various kinds in adulthood with the risk of chronic kidney disease (CKD) have been reported, but little is known about the association of childhood lifestyle with later life CKD. This study examined the relationship of HLS from child...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8722172/ https://www.ncbi.nlm.nih.gov/pubmed/34979963 http://dx.doi.org/10.1186/s12882-021-02627-0 |
_version_ | 1784625477280858112 |
---|---|
author | Liu, Conghui Tian, Jing Jose, Matthew D. He, Ye Dwyer, Terence Venn, Alison J. |
author_facet | Liu, Conghui Tian, Jing Jose, Matthew D. He, Ye Dwyer, Terence Venn, Alison J. |
author_sort | Liu, Conghui |
collection | PubMed |
description | BACKGROUND: The relationships of healthy lifestyle scores (HLS) of various kinds in adulthood with the risk of chronic kidney disease (CKD) have been reported, but little is known about the association of childhood lifestyle with later life CKD. This study examined the relationship of HLS from childhood to adulthood with subclinical kidney damage (SKD) in midlife, a surrogate measure for CKD. METHODS: Data were collected in an Australian population-based cohort study with 33 years follow-up. 750 participants with lifestyle information collected in childhood (ages 10–15 years) and midlife (ages 40–50 years), and measures of kidney function in midlife were included. The HLS was generated from the sum scores of five lifestyle factors (body mass index, smoking, alcohol consumption, physical activity, and diet). Each factor was scored as poor (0 point), intermediate (1 point), or ideal (2 points). Log-binomial regression was used to investigate the relationship of HLS in childhood and from childhood to adulthood with SKD defined as either 1) estimated glomerular filtration rate (eGFR) 30–60 mL/min/1.73m(2) or 2) eGFR> 60 mL/min/1.73m(2) with urine albumin-creatinine ratio ≥ 2.5 mg/mmol (males) or 3.5 mg/mmol (females), adjusting for socio-demographic factors and the duration of follow-up. RESULTS: The average HLS was 6.6 in childhood and 6.5 in midlife, and the prevalence of SKD was 4.9% (n = 36). Neither HLS in childhood nor HLS from childhood to adulthood were significantly associated with the risk of SKD in midlife. CONCLUSIONS: A HLS from childhood to adulthood did not predict SKD in this middle-aged, population-based Australian cohort. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12882-021-02627-0. |
format | Online Article Text |
id | pubmed-8722172 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-87221722022-01-06 Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study Liu, Conghui Tian, Jing Jose, Matthew D. He, Ye Dwyer, Terence Venn, Alison J. BMC Nephrol Research BACKGROUND: The relationships of healthy lifestyle scores (HLS) of various kinds in adulthood with the risk of chronic kidney disease (CKD) have been reported, but little is known about the association of childhood lifestyle with later life CKD. This study examined the relationship of HLS from childhood to adulthood with subclinical kidney damage (SKD) in midlife, a surrogate measure for CKD. METHODS: Data were collected in an Australian population-based cohort study with 33 years follow-up. 750 participants with lifestyle information collected in childhood (ages 10–15 years) and midlife (ages 40–50 years), and measures of kidney function in midlife were included. The HLS was generated from the sum scores of five lifestyle factors (body mass index, smoking, alcohol consumption, physical activity, and diet). Each factor was scored as poor (0 point), intermediate (1 point), or ideal (2 points). Log-binomial regression was used to investigate the relationship of HLS in childhood and from childhood to adulthood with SKD defined as either 1) estimated glomerular filtration rate (eGFR) 30–60 mL/min/1.73m(2) or 2) eGFR> 60 mL/min/1.73m(2) with urine albumin-creatinine ratio ≥ 2.5 mg/mmol (males) or 3.5 mg/mmol (females), adjusting for socio-demographic factors and the duration of follow-up. RESULTS: The average HLS was 6.6 in childhood and 6.5 in midlife, and the prevalence of SKD was 4.9% (n = 36). Neither HLS in childhood nor HLS from childhood to adulthood were significantly associated with the risk of SKD in midlife. CONCLUSIONS: A HLS from childhood to adulthood did not predict SKD in this middle-aged, population-based Australian cohort. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12882-021-02627-0. BioMed Central 2022-01-03 /pmc/articles/PMC8722172/ /pubmed/34979963 http://dx.doi.org/10.1186/s12882-021-02627-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Liu, Conghui Tian, Jing Jose, Matthew D. He, Ye Dwyer, Terence Venn, Alison J. Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title | Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title_full | Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title_fullStr | Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title_full_unstemmed | Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title_short | Associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
title_sort | associations of a healthy lifestyle score from childhood to adulthood with subclinical kidney damage in midlife: a population-based cohort study |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8722172/ https://www.ncbi.nlm.nih.gov/pubmed/34979963 http://dx.doi.org/10.1186/s12882-021-02627-0 |
work_keys_str_mv | AT liuconghui associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy AT tianjing associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy AT josematthewd associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy AT heye associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy AT dwyerterence associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy AT vennalisonj associationsofahealthylifestylescorefromchildhoodtoadulthoodwithsubclinicalkidneydamageinmidlifeapopulationbasedcohortstudy |