Cargando…

PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A

Glioma‐initiating cells (GICs), a major source of glioblastoma recurrence, are characterized by the expression of neural stem cell markers and the ability to grow by forming nonadherent spheres under serum‐free conditions. Bone morphogenetic proteins (BMPs), members of the transforming growth factor...

Descripción completa

Detalles Bibliográficos
Autores principales: Tanabe, Ryo, Miyazono, Kohei, Todo, Tomoki, Saito, Nobuhito, Iwata, Caname, Komuro, Akiyoshi, Sakai, Satoshi, Raja, Erna, Koinuma, Daizo, Morikawa, Masato, Westermark, Bengt, Heldin, Carl‐Henrik
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8732353/
https://www.ncbi.nlm.nih.gov/pubmed/34214250
http://dx.doi.org/10.1002/1878-0261.13051
_version_ 1784627568738041856
author Tanabe, Ryo
Miyazono, Kohei
Todo, Tomoki
Saito, Nobuhito
Iwata, Caname
Komuro, Akiyoshi
Sakai, Satoshi
Raja, Erna
Koinuma, Daizo
Morikawa, Masato
Westermark, Bengt
Heldin, Carl‐Henrik
author_facet Tanabe, Ryo
Miyazono, Kohei
Todo, Tomoki
Saito, Nobuhito
Iwata, Caname
Komuro, Akiyoshi
Sakai, Satoshi
Raja, Erna
Koinuma, Daizo
Morikawa, Masato
Westermark, Bengt
Heldin, Carl‐Henrik
author_sort Tanabe, Ryo
collection PubMed
description Glioma‐initiating cells (GICs), a major source of glioblastoma recurrence, are characterized by the expression of neural stem cell markers and the ability to grow by forming nonadherent spheres under serum‐free conditions. Bone morphogenetic proteins (BMPs), members of the transforming growth factor‐β family, induce differentiation of GICs and suppress their tumorigenicity. However, the mechanisms underlying the BMP‐induced loss of GIC stemness have not been fully elucidated. Here, we show that paired related homeobox 1 (PRRX1) induced by BMPs decreases the CD133‐positive GIC population and inhibits tumorigenic activity of GICs in vivo. Of the two splice isoforms of PRRX1, the longer isoform, pmx‐1b, but not the shorter isoform, pmx‐1a, induces GIC differentiation. Upon BMP stimulation, pmx‐1b interacts with the DNA methyltransferase DNMT3A and induces promoter methylation of the PROM1 gene encoding CD133. Silencing DNMT3A maintains PROM1 expression and increases the CD133‐positive GIC population. Thus, pmx‐1b promotes loss of stem cell‐like properties of GICs through region‐specific epigenetic regulation of CD133 expression by recruiting DNMT3A, which is associated with decreased tumorigenicity of GICs.
format Online
Article
Text
id pubmed-8732353
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-87323532022-01-11 PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A Tanabe, Ryo Miyazono, Kohei Todo, Tomoki Saito, Nobuhito Iwata, Caname Komuro, Akiyoshi Sakai, Satoshi Raja, Erna Koinuma, Daizo Morikawa, Masato Westermark, Bengt Heldin, Carl‐Henrik Mol Oncol Research Articles Glioma‐initiating cells (GICs), a major source of glioblastoma recurrence, are characterized by the expression of neural stem cell markers and the ability to grow by forming nonadherent spheres under serum‐free conditions. Bone morphogenetic proteins (BMPs), members of the transforming growth factor‐β family, induce differentiation of GICs and suppress their tumorigenicity. However, the mechanisms underlying the BMP‐induced loss of GIC stemness have not been fully elucidated. Here, we show that paired related homeobox 1 (PRRX1) induced by BMPs decreases the CD133‐positive GIC population and inhibits tumorigenic activity of GICs in vivo. Of the two splice isoforms of PRRX1, the longer isoform, pmx‐1b, but not the shorter isoform, pmx‐1a, induces GIC differentiation. Upon BMP stimulation, pmx‐1b interacts with the DNA methyltransferase DNMT3A and induces promoter methylation of the PROM1 gene encoding CD133. Silencing DNMT3A maintains PROM1 expression and increases the CD133‐positive GIC population. Thus, pmx‐1b promotes loss of stem cell‐like properties of GICs through region‐specific epigenetic regulation of CD133 expression by recruiting DNMT3A, which is associated with decreased tumorigenicity of GICs. John Wiley and Sons Inc. 2021-07-16 2022-01 /pmc/articles/PMC8732353/ /pubmed/34214250 http://dx.doi.org/10.1002/1878-0261.13051 Text en © 2021 The Authors. Molecular Oncology published by John Wiley & Sons Ltd on behalf of Federation of European Biochemical Societies https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Articles
Tanabe, Ryo
Miyazono, Kohei
Todo, Tomoki
Saito, Nobuhito
Iwata, Caname
Komuro, Akiyoshi
Sakai, Satoshi
Raja, Erna
Koinuma, Daizo
Morikawa, Masato
Westermark, Bengt
Heldin, Carl‐Henrik
PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title_full PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title_fullStr PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title_full_unstemmed PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title_short PRRX1 induced by BMP signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via DNA methyltransferase 3A
title_sort prrx1 induced by bmp signaling decreases tumorigenesis by epigenetically regulating glioma‐initiating cell properties via dna methyltransferase 3a
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8732353/
https://www.ncbi.nlm.nih.gov/pubmed/34214250
http://dx.doi.org/10.1002/1878-0261.13051
work_keys_str_mv AT tanaberyo prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT miyazonokohei prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT todotomoki prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT saitonobuhito prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT iwatacaname prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT komuroakiyoshi prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT sakaisatoshi prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT rajaerna prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT koinumadaizo prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT morikawamasato prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT westermarkbengt prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a
AT heldincarlhenrik prrx1inducedbybmpsignalingdecreasestumorigenesisbyepigeneticallyregulatinggliomainitiatingcellpropertiesviadnamethyltransferase3a