Cargando…
Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma
BACKGROUND: Invasive malignant pleomorphic adenoma (IMPA) is a highly malignant neoplasm of the oral salivary glands with a poor prognosis and a considerable risk of recurrence. Many disease-causing genes of IMPA have been identified in recent decades (e.g., P53, PCNA and HMGA2), but many of these g...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8734245/ https://www.ncbi.nlm.nih.gov/pubmed/34986855 http://dx.doi.org/10.1186/s12967-021-03204-7 |
_version_ | 1784627976182169600 |
---|---|
author | Han, Zhenyuan Ren, Huiping Sun, Jingjing Jin, Lihui Wang, Qin Guo, Chuanbin Tian, Zhen |
author_facet | Han, Zhenyuan Ren, Huiping Sun, Jingjing Jin, Lihui Wang, Qin Guo, Chuanbin Tian, Zhen |
author_sort | Han, Zhenyuan |
collection | PubMed |
description | BACKGROUND: Invasive malignant pleomorphic adenoma (IMPA) is a highly malignant neoplasm of the oral salivary glands with a poor prognosis and a considerable risk of recurrence. Many disease-causing genes of IMPA have been identified in recent decades (e.g., P53, PCNA and HMGA2), but many of these genes remain to be explored. Weighted gene coexpression network analysis (WGCNA) is a newly emerged algorithm that can cluster genes and form modules based on similar gene expression patterns. This study constructed a gene coexpression network of IMPA via WGCNA and then carried out multifaceted analysis to identify novel disease-causing genes. METHODS: RNA sequencing (RNA-seq) was performed for 10 pairs of IMPA and normal tissues to acquire the gene expression profiles. Differentially expressed genes (DEGs) were screened out with the cutoff criteria of |log(2) Fold change (FC)|> 1 and adjusted p value < 0.05. Then, WGCNA was applied to systematically identify the hidden diagnostic hub genes of IMPA. RESULTS: In this research, a total of 1970 DEGs were screened out in IMPA tissues, including 1056 upregulated DEGs and 914 downregulated DEGs. Functional enrichment analysis was performed for identified DEGs and revealed an enrichment of tumor-associated GO terms and KEGG pathways. We used WGCNA to identify gene module most relevant with the histological grade of IMPA. The gene FZD2 was then recognized as the hub gene of the selected module with the highest module membership (MM) value and intramodule connectivity in protein–protein interaction (PPI) network. According to immunohistochemistry (IHC) staining, the expression level of FZD2 was higher in low-grade IMPA than in high-grade IMPA. CONCLUSION: FZD2 shows an expression dynamic that is negatively correlated with the clinical malignancy of IMPA and it plays a central role in the transcription network of IMPA. Thus, FZD2 serves as a promising histological indicator for the precise prediction of IMPA histological stages. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12967-021-03204-7. |
format | Online Article Text |
id | pubmed-8734245 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-87342452022-01-07 Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma Han, Zhenyuan Ren, Huiping Sun, Jingjing Jin, Lihui Wang, Qin Guo, Chuanbin Tian, Zhen J Transl Med Research BACKGROUND: Invasive malignant pleomorphic adenoma (IMPA) is a highly malignant neoplasm of the oral salivary glands with a poor prognosis and a considerable risk of recurrence. Many disease-causing genes of IMPA have been identified in recent decades (e.g., P53, PCNA and HMGA2), but many of these genes remain to be explored. Weighted gene coexpression network analysis (WGCNA) is a newly emerged algorithm that can cluster genes and form modules based on similar gene expression patterns. This study constructed a gene coexpression network of IMPA via WGCNA and then carried out multifaceted analysis to identify novel disease-causing genes. METHODS: RNA sequencing (RNA-seq) was performed for 10 pairs of IMPA and normal tissues to acquire the gene expression profiles. Differentially expressed genes (DEGs) were screened out with the cutoff criteria of |log(2) Fold change (FC)|> 1 and adjusted p value < 0.05. Then, WGCNA was applied to systematically identify the hidden diagnostic hub genes of IMPA. RESULTS: In this research, a total of 1970 DEGs were screened out in IMPA tissues, including 1056 upregulated DEGs and 914 downregulated DEGs. Functional enrichment analysis was performed for identified DEGs and revealed an enrichment of tumor-associated GO terms and KEGG pathways. We used WGCNA to identify gene module most relevant with the histological grade of IMPA. The gene FZD2 was then recognized as the hub gene of the selected module with the highest module membership (MM) value and intramodule connectivity in protein–protein interaction (PPI) network. According to immunohistochemistry (IHC) staining, the expression level of FZD2 was higher in low-grade IMPA than in high-grade IMPA. CONCLUSION: FZD2 shows an expression dynamic that is negatively correlated with the clinical malignancy of IMPA and it plays a central role in the transcription network of IMPA. Thus, FZD2 serves as a promising histological indicator for the precise prediction of IMPA histological stages. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12967-021-03204-7. BioMed Central 2022-01-05 /pmc/articles/PMC8734245/ /pubmed/34986855 http://dx.doi.org/10.1186/s12967-021-03204-7 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Han, Zhenyuan Ren, Huiping Sun, Jingjing Jin, Lihui Wang, Qin Guo, Chuanbin Tian, Zhen Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title | Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title_full | Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title_fullStr | Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title_full_unstemmed | Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title_short | Integrated weighted gene coexpression network analysis identifies Frizzled 2 (FZD2) as a key gene in invasive malignant pleomorphic adenoma |
title_sort | integrated weighted gene coexpression network analysis identifies frizzled 2 (fzd2) as a key gene in invasive malignant pleomorphic adenoma |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8734245/ https://www.ncbi.nlm.nih.gov/pubmed/34986855 http://dx.doi.org/10.1186/s12967-021-03204-7 |
work_keys_str_mv | AT hanzhenyuan integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT renhuiping integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT sunjingjing integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT jinlihui integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT wangqin integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT guochuanbin integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma AT tianzhen integratedweightedgenecoexpressionnetworkanalysisidentifiesfrizzled2fzd2asakeygeneininvasivemalignantpleomorphicadenoma |