Cargando…
Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review
Patients with chronic kidney disease (CKD) are at a highly increased risk of cardiovascular complications, with increased vascular inflammation, accelerated atherogenesis and enhanced thrombotic risk. Considering the central role of the endothelium in protecting from atherogenesis and thrombosis, as...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8745705/ https://www.ncbi.nlm.nih.gov/pubmed/35008960 http://dx.doi.org/10.3390/ijms23010531 |
_version_ | 1784630410042408960 |
---|---|
author | Harlacher, Eva Wollenhaupt, Julia Baaten, Constance C. F. M. J. Noels, Heidi |
author_facet | Harlacher, Eva Wollenhaupt, Julia Baaten, Constance C. F. M. J. Noels, Heidi |
author_sort | Harlacher, Eva |
collection | PubMed |
description | Patients with chronic kidney disease (CKD) are at a highly increased risk of cardiovascular complications, with increased vascular inflammation, accelerated atherogenesis and enhanced thrombotic risk. Considering the central role of the endothelium in protecting from atherogenesis and thrombosis, as well as its cardioprotective role in regulating vasorelaxation, this study aimed to systematically integrate literature on CKD-associated endothelial dysfunction, including the underlying molecular mechanisms, into a comprehensive overview. Therefore, we conducted a systematic review of literature describing uremic serum or uremic toxin-induced vascular dysfunction with a special focus on the endothelium. This revealed 39 studies analyzing the effects of uremic serum or the uremic toxins indoxyl sulfate, cyanate, modified LDL, the advanced glycation end products N-carboxymethyl-lysine and N-carboxyethyl-lysine, p-cresol and p-cresyl sulfate, phosphate, uric acid and asymmetric dimethylarginine. Most studies described an increase in inflammation, oxidative stress, leukocyte migration and adhesion, cell death and a thrombotic phenotype upon uremic conditions or uremic toxin treatment of endothelial cells. Cellular signaling pathways that were frequently activated included the ROS, MAPK/NF-κB, the Aryl-Hydrocarbon-Receptor and RAGE pathways. Overall, this review provides detailed insights into pathophysiological and molecular mechanisms underlying endothelial dysfunction in CKD. Targeting these pathways may provide new therapeutic strategies reducing increased the cardiovascular risk in CKD. |
format | Online Article Text |
id | pubmed-8745705 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-87457052022-01-11 Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review Harlacher, Eva Wollenhaupt, Julia Baaten, Constance C. F. M. J. Noels, Heidi Int J Mol Sci Review Patients with chronic kidney disease (CKD) are at a highly increased risk of cardiovascular complications, with increased vascular inflammation, accelerated atherogenesis and enhanced thrombotic risk. Considering the central role of the endothelium in protecting from atherogenesis and thrombosis, as well as its cardioprotective role in regulating vasorelaxation, this study aimed to systematically integrate literature on CKD-associated endothelial dysfunction, including the underlying molecular mechanisms, into a comprehensive overview. Therefore, we conducted a systematic review of literature describing uremic serum or uremic toxin-induced vascular dysfunction with a special focus on the endothelium. This revealed 39 studies analyzing the effects of uremic serum or the uremic toxins indoxyl sulfate, cyanate, modified LDL, the advanced glycation end products N-carboxymethyl-lysine and N-carboxyethyl-lysine, p-cresol and p-cresyl sulfate, phosphate, uric acid and asymmetric dimethylarginine. Most studies described an increase in inflammation, oxidative stress, leukocyte migration and adhesion, cell death and a thrombotic phenotype upon uremic conditions or uremic toxin treatment of endothelial cells. Cellular signaling pathways that were frequently activated included the ROS, MAPK/NF-κB, the Aryl-Hydrocarbon-Receptor and RAGE pathways. Overall, this review provides detailed insights into pathophysiological and molecular mechanisms underlying endothelial dysfunction in CKD. Targeting these pathways may provide new therapeutic strategies reducing increased the cardiovascular risk in CKD. MDPI 2022-01-04 /pmc/articles/PMC8745705/ /pubmed/35008960 http://dx.doi.org/10.3390/ijms23010531 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Harlacher, Eva Wollenhaupt, Julia Baaten, Constance C. F. M. J. Noels, Heidi Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title | Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title_full | Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title_fullStr | Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title_full_unstemmed | Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title_short | Impact of Uremic Toxins on Endothelial Dysfunction in Chronic Kidney Disease: A Systematic Review |
title_sort | impact of uremic toxins on endothelial dysfunction in chronic kidney disease: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8745705/ https://www.ncbi.nlm.nih.gov/pubmed/35008960 http://dx.doi.org/10.3390/ijms23010531 |
work_keys_str_mv | AT harlachereva impactofuremictoxinsonendothelialdysfunctioninchronickidneydiseaseasystematicreview AT wollenhauptjulia impactofuremictoxinsonendothelialdysfunctioninchronickidneydiseaseasystematicreview AT baatenconstancecfmj impactofuremictoxinsonendothelialdysfunctioninchronickidneydiseaseasystematicreview AT noelsheidi impactofuremictoxinsonendothelialdysfunctioninchronickidneydiseaseasystematicreview |