Cargando…
Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant
BACKGROUND: Antibody response against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) after mRNA or adenoviral vector-based vaccines is weak in kidney transplant (KT) patients. However, few studies have focused on humoral response after inactivated virus-based vaccines in KT. Here, we c...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8755301/ https://www.ncbi.nlm.nih.gov/pubmed/35198159 http://dx.doi.org/10.1093/ckj/sfab291 |
_version_ | 1784632363099095040 |
---|---|
author | Seija, Mariana Rammauro, Florencia Santiago, José Orihuela, Natalia Zulberti, Catherine Machado, Danilo Recalde, Cecilia Noboa, Javier Frantchez, Victoria Astesiano, Rossana Yandián, Federico Guerisoli, Ana Morra, Álvaro Cassinelli, Daniela Coelho, Cecilia de Aramburu, Belén González-Severgnini, Paulina Moreno, Romina Pippolo, Aldana López, Gabriela Lemos, Mónica Somariva, Lorena López, Eliana Fumero, Soledad Orihuela, Carla Rodríguez, Rosalía Acuña, Gonzalo Rabaza, Victoria Perg, Nancy Cordero, Rossana Reisfeld, Cristina Olivera, Paula Montero, Paola Nogueira, Cecilia Nalerio, Catheryn Orihuela, Sergio Curi, Lilián Burgstaller, Ema Noboa, Oscar Pritsch, Otto Nin, Marcelo Bianchi, Sergio |
author_facet | Seija, Mariana Rammauro, Florencia Santiago, José Orihuela, Natalia Zulberti, Catherine Machado, Danilo Recalde, Cecilia Noboa, Javier Frantchez, Victoria Astesiano, Rossana Yandián, Federico Guerisoli, Ana Morra, Álvaro Cassinelli, Daniela Coelho, Cecilia de Aramburu, Belén González-Severgnini, Paulina Moreno, Romina Pippolo, Aldana López, Gabriela Lemos, Mónica Somariva, Lorena López, Eliana Fumero, Soledad Orihuela, Carla Rodríguez, Rosalía Acuña, Gonzalo Rabaza, Victoria Perg, Nancy Cordero, Rossana Reisfeld, Cristina Olivera, Paula Montero, Paola Nogueira, Cecilia Nalerio, Catheryn Orihuela, Sergio Curi, Lilián Burgstaller, Ema Noboa, Oscar Pritsch, Otto Nin, Marcelo Bianchi, Sergio |
author_sort | Seija, Mariana |
collection | PubMed |
description | BACKGROUND: Antibody response against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) after mRNA or adenoviral vector-based vaccines is weak in kidney transplant (KT) patients. However, few studies have focused on humoral response after inactivated virus-based vaccines in KT. Here, we compare antibody response following vaccination with inactivated virus (CoronaVac®) and BNT162b2 mRNA. METHODS: A national multicentre cross-sectional study was conducted. The study group was composed of patients from all KT centres in Uruguay, vaccinated between 1 and 31 May 2021 (CoronaVac®, n = 245 and BNT162b2, n = 39). The control group was constituted of 82 healthy individuals. Participants had no prior confirmed coronavirus disease 2019 (COVID-19) test. Blood samples were collected between 30 and 40 days after the second dose. Serum-specific immunoglobulin G (IgG) antibodies against the receptor-binding domain (RBD) of SARS-CoV-2 Spike protein were determined using the COVID-19 IgG QUANT ELISA Kit. RESULTS: Only 29% of KT recipients showed seroconversion (36.5% BNT162b2, 27.8% inactivated virus, P = 0.248) in comparison with 100% in healthy control with either vaccine. Antibody levels against RBD were higher with BNT162b mRNA than with inactivated virus [median (interquartile range) 173 (73–554) and 29 (11–70) binding antibody units (BAU)/mL, P < 0.034] in KT and 10 times lower than healthy control [inactivated virus: 308 (209–335) and BNT162b2: 2638 (2608–3808) BAU/mL, P < 0.034]. In multivariate analysis, variables associated with negative humoral response were age, triple immunosuppression, estimated glomerular filtration rate and time post-KT. CONCLUSION: Seroconversion was low in KT patients after vaccination with both platforms. Antibody levels against SARS-CoV-2 were lower with inactivated virus than BNT162b mRNA. These findings support the need for strategies to improve immunogenicity in KT recipients after two doses of either vaccine. |
format | Online Article Text |
id | pubmed-8755301 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-87553012022-01-13 Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant Seija, Mariana Rammauro, Florencia Santiago, José Orihuela, Natalia Zulberti, Catherine Machado, Danilo Recalde, Cecilia Noboa, Javier Frantchez, Victoria Astesiano, Rossana Yandián, Federico Guerisoli, Ana Morra, Álvaro Cassinelli, Daniela Coelho, Cecilia de Aramburu, Belén González-Severgnini, Paulina Moreno, Romina Pippolo, Aldana López, Gabriela Lemos, Mónica Somariva, Lorena López, Eliana Fumero, Soledad Orihuela, Carla Rodríguez, Rosalía Acuña, Gonzalo Rabaza, Victoria Perg, Nancy Cordero, Rossana Reisfeld, Cristina Olivera, Paula Montero, Paola Nogueira, Cecilia Nalerio, Catheryn Orihuela, Sergio Curi, Lilián Burgstaller, Ema Noboa, Oscar Pritsch, Otto Nin, Marcelo Bianchi, Sergio Clin Kidney J Original Article BACKGROUND: Antibody response against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) after mRNA or adenoviral vector-based vaccines is weak in kidney transplant (KT) patients. However, few studies have focused on humoral response after inactivated virus-based vaccines in KT. Here, we compare antibody response following vaccination with inactivated virus (CoronaVac®) and BNT162b2 mRNA. METHODS: A national multicentre cross-sectional study was conducted. The study group was composed of patients from all KT centres in Uruguay, vaccinated between 1 and 31 May 2021 (CoronaVac®, n = 245 and BNT162b2, n = 39). The control group was constituted of 82 healthy individuals. Participants had no prior confirmed coronavirus disease 2019 (COVID-19) test. Blood samples were collected between 30 and 40 days after the second dose. Serum-specific immunoglobulin G (IgG) antibodies against the receptor-binding domain (RBD) of SARS-CoV-2 Spike protein were determined using the COVID-19 IgG QUANT ELISA Kit. RESULTS: Only 29% of KT recipients showed seroconversion (36.5% BNT162b2, 27.8% inactivated virus, P = 0.248) in comparison with 100% in healthy control with either vaccine. Antibody levels against RBD were higher with BNT162b mRNA than with inactivated virus [median (interquartile range) 173 (73–554) and 29 (11–70) binding antibody units (BAU)/mL, P < 0.034] in KT and 10 times lower than healthy control [inactivated virus: 308 (209–335) and BNT162b2: 2638 (2608–3808) BAU/mL, P < 0.034]. In multivariate analysis, variables associated with negative humoral response were age, triple immunosuppression, estimated glomerular filtration rate and time post-KT. CONCLUSION: Seroconversion was low in KT patients after vaccination with both platforms. Antibody levels against SARS-CoV-2 were lower with inactivated virus than BNT162b mRNA. These findings support the need for strategies to improve immunogenicity in KT recipients after two doses of either vaccine. Oxford University Press 2021-12-27 /pmc/articles/PMC8755301/ /pubmed/35198159 http://dx.doi.org/10.1093/ckj/sfab291 Text en © The Author(s) 2021. Published by Oxford University Press on behalf of the ERA. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (https://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com |
spellingShingle | Original Article Seija, Mariana Rammauro, Florencia Santiago, José Orihuela, Natalia Zulberti, Catherine Machado, Danilo Recalde, Cecilia Noboa, Javier Frantchez, Victoria Astesiano, Rossana Yandián, Federico Guerisoli, Ana Morra, Álvaro Cassinelli, Daniela Coelho, Cecilia de Aramburu, Belén González-Severgnini, Paulina Moreno, Romina Pippolo, Aldana López, Gabriela Lemos, Mónica Somariva, Lorena López, Eliana Fumero, Soledad Orihuela, Carla Rodríguez, Rosalía Acuña, Gonzalo Rabaza, Victoria Perg, Nancy Cordero, Rossana Reisfeld, Cristina Olivera, Paula Montero, Paola Nogueira, Cecilia Nalerio, Catheryn Orihuela, Sergio Curi, Lilián Burgstaller, Ema Noboa, Oscar Pritsch, Otto Nin, Marcelo Bianchi, Sergio Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title | Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title_full | Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title_fullStr | Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title_full_unstemmed | Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title_short | Comparison of antibody response to SARS-CoV-2 after two doses of inactivated virus and BNT162b2 mRNA vaccines in kidney transplant |
title_sort | comparison of antibody response to sars-cov-2 after two doses of inactivated virus and bnt162b2 mrna vaccines in kidney transplant |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8755301/ https://www.ncbi.nlm.nih.gov/pubmed/35198159 http://dx.doi.org/10.1093/ckj/sfab291 |
work_keys_str_mv | AT seijamariana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT rammauroflorencia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT santiagojose comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT orihuelanatalia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT zulberticatherine comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT machadodanilo comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT recaldececilia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT noboajavier comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT frantchezvictoria comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT astesianorossana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT yandianfederico comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT guerisoliana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT morraalvaro comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT cassinellidaniela comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT coelhocecilia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT dearamburubelen comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT gonzalezsevergninipaulina comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT morenoromina comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT pippoloaldana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT lopezgabriela comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT lemosmonica comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT somarivalorena comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT lopezeliana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT fumerosoledad comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT orihuelacarla comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT rodriguezrosalia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT acunagonzalo comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT rabazavictoria comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT pergnancy comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT corderorossana comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT reisfeldcristina comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT oliverapaula comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT monteropaola comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT nogueiracecilia comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT naleriocatheryn comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT orihuelasergio comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT curililian comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT burgstallerema comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT noboaoscar comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT pritschotto comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT ninmarcelo comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant AT bianchisergio comparisonofantibodyresponsetosarscov2aftertwodosesofinactivatedvirusandbnt162b2mrnavaccinesinkidneytransplant |