Cargando…
As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC
BACKGROUND: Male partner’s approval is a key determinant of contraceptive use for women living in Sub-Saharan Africa and improving men’s support and couple communication is a cornerstone of family planning programs. However, approval is often only measured through the women’s perception of their par...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8756630/ https://www.ncbi.nlm.nih.gov/pubmed/35022043 http://dx.doi.org/10.1186/s12978-021-01256-y |
_version_ | 1784632599654694912 |
---|---|
author | Hernandez, Julie H. Babazadeh, Saleh Anglewicz, Philip A. Akilimali, Pierre Z. |
author_facet | Hernandez, Julie H. Babazadeh, Saleh Anglewicz, Philip A. Akilimali, Pierre Z. |
author_sort | Hernandez, Julie H. |
collection | PubMed |
description | BACKGROUND: Male partner’s approval is a key determinant of contraceptive use for women living in Sub-Saharan Africa and improving men’s support and couple communication is a cornerstone of family planning programs. However, approval is often only measured through the women’s perception of their partner’s opinion. METHODS: This study conducted in Kinshasa compares contraceptive approval variables from matched male and female partners (n = 252 couples) to establish the frequency of (in)accurate perceptions by the woman, then test their association with modern contraceptive use. Additional regressions estimate individual and couple variables associated with (in)correct perceptions. RESULTS: Results confirm women are poorly aware of their partner’s opinion but indicate that perceived approval or disapproval by the woman is a much stronger determinant of modern contraceptive use than her partner’s actual opinion. Higher educational achievement from the woman is the strongest driver of misunderstanding her partner’s approval. CONCLUSIONS: Women’s perceptions of partner’s approval are much stronger determinant of contraceptive use than the latter’s actual opinion, and stereotyping men’s opinion of family planning is a common error of appreciation. However, findings also suggest these misunderstandings might serve women’s capacity to negotiate contraceptive use. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12978-021-01256-y. |
format | Online Article Text |
id | pubmed-8756630 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-87566302022-01-18 As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC Hernandez, Julie H. Babazadeh, Saleh Anglewicz, Philip A. Akilimali, Pierre Z. Reprod Health Research BACKGROUND: Male partner’s approval is a key determinant of contraceptive use for women living in Sub-Saharan Africa and improving men’s support and couple communication is a cornerstone of family planning programs. However, approval is often only measured through the women’s perception of their partner’s opinion. METHODS: This study conducted in Kinshasa compares contraceptive approval variables from matched male and female partners (n = 252 couples) to establish the frequency of (in)accurate perceptions by the woman, then test their association with modern contraceptive use. Additional regressions estimate individual and couple variables associated with (in)correct perceptions. RESULTS: Results confirm women are poorly aware of their partner’s opinion but indicate that perceived approval or disapproval by the woman is a much stronger determinant of modern contraceptive use than her partner’s actual opinion. Higher educational achievement from the woman is the strongest driver of misunderstanding her partner’s approval. CONCLUSIONS: Women’s perceptions of partner’s approval are much stronger determinant of contraceptive use than the latter’s actual opinion, and stereotyping men’s opinion of family planning is a common error of appreciation. However, findings also suggest these misunderstandings might serve women’s capacity to negotiate contraceptive use. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12978-021-01256-y. BioMed Central 2022-01-12 /pmc/articles/PMC8756630/ /pubmed/35022043 http://dx.doi.org/10.1186/s12978-021-01256-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Hernandez, Julie H. Babazadeh, Saleh Anglewicz, Philip A. Akilimali, Pierre Z. As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title | As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title_full | As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title_fullStr | As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title_full_unstemmed | As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title_short | As long as (I think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in Kinshasa, DRC |
title_sort | as long as (i think) my husband agrees…: role of perceived partner approval in contraceptive use among couples living in military camps in kinshasa, drc |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8756630/ https://www.ncbi.nlm.nih.gov/pubmed/35022043 http://dx.doi.org/10.1186/s12978-021-01256-y |
work_keys_str_mv | AT hernandezjulieh aslongasithinkmyhusbandagreesroleofperceivedpartnerapprovalincontraceptiveuseamongcoupleslivinginmilitarycampsinkinshasadrc AT babazadehsaleh aslongasithinkmyhusbandagreesroleofperceivedpartnerapprovalincontraceptiveuseamongcoupleslivinginmilitarycampsinkinshasadrc AT anglewiczphilipa aslongasithinkmyhusbandagreesroleofperceivedpartnerapprovalincontraceptiveuseamongcoupleslivinginmilitarycampsinkinshasadrc AT akilimalipierrez aslongasithinkmyhusbandagreesroleofperceivedpartnerapprovalincontraceptiveuseamongcoupleslivinginmilitarycampsinkinshasadrc |