Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury

Various immune cells and cytokines are present in the aftermath of peripheral nerve injuries (PNI), and coordination of the local inflammatory response is of great significance for the recovery of PNI. Mesenchymal stem cells (MSCs) exhibit immunosuppressive and anti-inflammatory abilities which can...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Xiangling, Guan, Yanjun, Li, Chaochao, Zhang, Tieyuan, Meng, Fanqi, Zhang, Jian, Li, Junyang, Chen, Shengfeng, Wang, Qi, Wang, Yi, Peng, Jiang, Tang, Jinshu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Review
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8760713/
https://www.ncbi.nlm.nih.gov/pubmed/35033187
http://dx.doi.org/10.1186/s13287-021-02690-2
_version_ 1784633380878417920
author Li, Xiangling
Guan, Yanjun
Li, Chaochao
Zhang, Tieyuan
Meng, Fanqi
Zhang, Jian
Li, Junyang
Chen, Shengfeng
Wang, Qi
Wang, Yi
Peng, Jiang
Tang, Jinshu
author_facet Li, Xiangling
Guan, Yanjun
Li, Chaochao
Zhang, Tieyuan
Meng, Fanqi
Zhang, Jian
Li, Junyang
Chen, Shengfeng
Wang, Qi
Wang, Yi
Peng, Jiang
Tang, Jinshu
author_sort Li, Xiangling
collection PubMed
description Various immune cells and cytokines are present in the aftermath of peripheral nerve injuries (PNI), and coordination of the local inflammatory response is of great significance for the recovery of PNI. Mesenchymal stem cells (MSCs) exhibit immunosuppressive and anti-inflammatory abilities which can accelerate tissue regeneration and attenuate inflammation, but the role of MSCs in the regulation of the local inflammatory microenvironment after PNI has not been widely studied. Here, we summarize the known interactions between MSCs, immune cells, and inflammatory cytokines following PNI with a focus on the immunosuppressive role of MSCs. We also discuss the immunomodulatory potential of MSC-derived extracellular vesicles as a new cell-free treatment for PNI.
format Online
Article
Text
id pubmed-8760713
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-87607132022-01-18 Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury Li, Xiangling Guan, Yanjun Li, Chaochao Zhang, Tieyuan Meng, Fanqi Zhang, Jian Li, Junyang Chen, Shengfeng Wang, Qi Wang, Yi Peng, Jiang Tang, Jinshu Stem Cell Res Ther Review Various immune cells and cytokines are present in the aftermath of peripheral nerve injuries (PNI), and coordination of the local inflammatory response is of great significance for the recovery of PNI. Mesenchymal stem cells (MSCs) exhibit immunosuppressive and anti-inflammatory abilities which can accelerate tissue regeneration and attenuate inflammation, but the role of MSCs in the regulation of the local inflammatory microenvironment after PNI has not been widely studied. Here, we summarize the known interactions between MSCs, immune cells, and inflammatory cytokines following PNI with a focus on the immunosuppressive role of MSCs. We also discuss the immunomodulatory potential of MSC-derived extracellular vesicles as a new cell-free treatment for PNI. BioMed Central 2022-01-15 /pmc/articles/PMC8760713/ /pubmed/35033187 http://dx.doi.org/10.1186/s13287-021-02690-2 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Li, Xiangling
Guan, Yanjun
Li, Chaochao
Zhang, Tieyuan
Meng, Fanqi
Zhang, Jian
Li, Junyang
Chen, Shengfeng
Wang, Qi
Wang, Yi
Peng, Jiang
Tang, Jinshu
Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title_full Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title_fullStr Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title_full_unstemmed Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title_short Immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
title_sort immunomodulatory effects of mesenchymal stem cells in peripheral nerve injury
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8760713/
https://www.ncbi.nlm.nih.gov/pubmed/35033187
http://dx.doi.org/10.1186/s13287-021-02690-2
work_keys_str_mv AT lixiangling immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT guanyanjun immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT lichaochao immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT zhangtieyuan immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT mengfanqi immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT zhangjian immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT lijunyang immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT chenshengfeng immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT wangqi immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT wangyi immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT pengjiang immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury
AT tangjinshu immunomodulatoryeffectsofmesenchymalstemcellsinperipheralnerveinjury

Ejemplares similares