Cargando…
Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus)
SIMPLE SUMMARY: Slow growth and germplasm degradation have restricted the sustainable commercial development of the sea cucumber industry. To analyze the genetic mechanism of growth traits of sea cucumbers, we constructed a high-density genetic linkage map based on single nucleotide polymorphism (SN...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8772784/ https://www.ncbi.nlm.nih.gov/pubmed/35053048 http://dx.doi.org/10.3390/biology11010050 |
_version_ | 1784635924921974784 |
---|---|
author | Cui, Wei Huo, Da Liu, Shilin Xing, Lili Su, Fang Yang, Hongsheng Sun, Lina |
author_facet | Cui, Wei Huo, Da Liu, Shilin Xing, Lili Su, Fang Yang, Hongsheng Sun, Lina |
author_sort | Cui, Wei |
collection | PubMed |
description | SIMPLE SUMMARY: Slow growth and germplasm degradation have restricted the sustainable commercial development of the sea cucumber industry. To analyze the genetic mechanism of growth traits of sea cucumbers, we constructed a high-density genetic linkage map based on single nucleotide polymorphism (SNP) molecular markers and performed a quantitative trait loci (QTL) mapping analysis. We annotated a critical candidate gene related to growth traits and explored mRNA expression levels. The results showed that the gene was significantly highly expressed during the larval developmental stages. These results can be used to genetically improve the growth traits of sea cucumbers. ABSTRACT: Genetic linkage maps have become an indispensable tool for genetics and genomics research. Sea cucumber (Apostichopus japonicus), which is an economically important mariculture species in Asia, is an edible echinoderm with medicinal properties. In this study, the first SNP-based high-density genetic linkage map was constructed by sequencing 132 A. japonicus individuals (2 parents and 130 offspring) according to a genotyping-by-sequencing (GBS) method. The consensus map was 3181.54 cM long, with an average genetic distance of 0.52 cM. A total of 6144 SNPs were assigned to 22 linkage groups (LGs). A Pearson analysis and QTL mapping revealed the correlations among body weight, body length, and papillae number. An important growth-related candidate gene, protein still life, isoforms C/SIF type 2 (sif), was identified in LG18. The gene was significantly highly expressed during the larval developmental stages. Its encoded protein reportedly functions as a guanine nucleotide exchange factor. These results would facilitate the genetic analysis of growth traits and provide valuable genomic resources for the selection and breeding of new varieties of sea cucumbers with excellent production traits. |
format | Online Article Text |
id | pubmed-8772784 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-87727842022-01-21 Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) Cui, Wei Huo, Da Liu, Shilin Xing, Lili Su, Fang Yang, Hongsheng Sun, Lina Biology (Basel) Article SIMPLE SUMMARY: Slow growth and germplasm degradation have restricted the sustainable commercial development of the sea cucumber industry. To analyze the genetic mechanism of growth traits of sea cucumbers, we constructed a high-density genetic linkage map based on single nucleotide polymorphism (SNP) molecular markers and performed a quantitative trait loci (QTL) mapping analysis. We annotated a critical candidate gene related to growth traits and explored mRNA expression levels. The results showed that the gene was significantly highly expressed during the larval developmental stages. These results can be used to genetically improve the growth traits of sea cucumbers. ABSTRACT: Genetic linkage maps have become an indispensable tool for genetics and genomics research. Sea cucumber (Apostichopus japonicus), which is an economically important mariculture species in Asia, is an edible echinoderm with medicinal properties. In this study, the first SNP-based high-density genetic linkage map was constructed by sequencing 132 A. japonicus individuals (2 parents and 130 offspring) according to a genotyping-by-sequencing (GBS) method. The consensus map was 3181.54 cM long, with an average genetic distance of 0.52 cM. A total of 6144 SNPs were assigned to 22 linkage groups (LGs). A Pearson analysis and QTL mapping revealed the correlations among body weight, body length, and papillae number. An important growth-related candidate gene, protein still life, isoforms C/SIF type 2 (sif), was identified in LG18. The gene was significantly highly expressed during the larval developmental stages. Its encoded protein reportedly functions as a guanine nucleotide exchange factor. These results would facilitate the genetic analysis of growth traits and provide valuable genomic resources for the selection and breeding of new varieties of sea cucumbers with excellent production traits. MDPI 2021-12-30 /pmc/articles/PMC8772784/ /pubmed/35053048 http://dx.doi.org/10.3390/biology11010050 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Cui, Wei Huo, Da Liu, Shilin Xing, Lili Su, Fang Yang, Hongsheng Sun, Lina Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title | Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title_full | Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title_fullStr | Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title_full_unstemmed | Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title_short | Construction of a High-Density Genetic Linkage Map for the Mapping of QTL Associated with Growth-Related Traits in Sea Cucumber (Apostichopus japonicus) |
title_sort | construction of a high-density genetic linkage map for the mapping of qtl associated with growth-related traits in sea cucumber (apostichopus japonicus) |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8772784/ https://www.ncbi.nlm.nih.gov/pubmed/35053048 http://dx.doi.org/10.3390/biology11010050 |
work_keys_str_mv | AT cuiwei constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT huoda constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT liushilin constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT xinglili constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT sufang constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT yanghongsheng constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus AT sunlina constructionofahighdensitygeneticlinkagemapforthemappingofqtlassociatedwithgrowthrelatedtraitsinseacucumberapostichopusjaponicus |