Cargando…
Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic se...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8779792/ https://www.ncbi.nlm.nih.gov/pubmed/35056456 http://dx.doi.org/10.3390/microorganisms10010007 |
_version_ | 1784637664335495168 |
---|---|
author | Conrad, Steven J. Oluwayinka, Eniope B. Heidari, Mohammad Mays, Jody K. Dunn, John R. |
author_facet | Conrad, Steven J. Oluwayinka, Eniope B. Heidari, Mohammad Mays, Jody K. Dunn, John R. |
author_sort | Conrad, Steven J. |
collection | PubMed |
description | Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic serotypes of MDV (GaHV-3), or non-pathogenic strains of the related Melagrid alphaherpesvirus 1 (MeHV-1). One attractive strategy for the production of new vaccine strains is a recombinant MDV attenuated by the deletion of the major viral oncogene meq. However, meq-deleted variants of MDV cause atrophy of the bursa and thymus in maternal antibody-negative chickens, and the resulting immunosuppression makes them unsuitable. Herein we detail our attempt to mitigate the lymphoid atrophy caused by meq-deleted MDV by further attenuation of the virus through ablation of the viral thymidine kinase (tk) gene. We demonstrate that ablation of the viral tk from the meq-deleted virus rMd5B40/Δmeq resulted in a virus attenuated for replication in vitro and which spared chickens from atrophy of the lymphoid organs in vivo. When the rMd5B40/Δmeq/Δtk/GFP was used as a vaccine it was protective against challenge with the vv+MDV strain 686, but the protection was less than that provided by the CVI988/Rispens vaccine. |
format | Online Article Text |
id | pubmed-8779792 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-87797922022-01-22 Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective Conrad, Steven J. Oluwayinka, Eniope B. Heidari, Mohammad Mays, Jody K. Dunn, John R. Microorganisms Article Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic serotypes of MDV (GaHV-3), or non-pathogenic strains of the related Melagrid alphaherpesvirus 1 (MeHV-1). One attractive strategy for the production of new vaccine strains is a recombinant MDV attenuated by the deletion of the major viral oncogene meq. However, meq-deleted variants of MDV cause atrophy of the bursa and thymus in maternal antibody-negative chickens, and the resulting immunosuppression makes them unsuitable. Herein we detail our attempt to mitigate the lymphoid atrophy caused by meq-deleted MDV by further attenuation of the virus through ablation of the viral thymidine kinase (tk) gene. We demonstrate that ablation of the viral tk from the meq-deleted virus rMd5B40/Δmeq resulted in a virus attenuated for replication in vitro and which spared chickens from atrophy of the lymphoid organs in vivo. When the rMd5B40/Δmeq/Δtk/GFP was used as a vaccine it was protective against challenge with the vv+MDV strain 686, but the protection was less than that provided by the CVI988/Rispens vaccine. MDPI 2021-12-22 /pmc/articles/PMC8779792/ /pubmed/35056456 http://dx.doi.org/10.3390/microorganisms10010007 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Conrad, Steven J. Oluwayinka, Eniope B. Heidari, Mohammad Mays, Jody K. Dunn, John R. Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title | Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title_full | Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title_fullStr | Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title_full_unstemmed | Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title_short | Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective |
title_sort | deletion of the viral thymidine kinase in a meq-deleted recombinant marek’s disease virus reduces lymphoid atrophy but is less protective |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8779792/ https://www.ncbi.nlm.nih.gov/pubmed/35056456 http://dx.doi.org/10.3390/microorganisms10010007 |
work_keys_str_mv | AT conradstevenj deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective AT oluwayinkaeniopeb deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective AT heidarimohammad deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective AT maysjodyk deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective AT dunnjohnr deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective |