Cargando…

Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective

Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic se...

Descripción completa

Detalles Bibliográficos
Autores principales: Conrad, Steven J., Oluwayinka, Eniope B., Heidari, Mohammad, Mays, Jody K., Dunn, John R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8779792/
https://www.ncbi.nlm.nih.gov/pubmed/35056456
http://dx.doi.org/10.3390/microorganisms10010007
_version_ 1784637664335495168
author Conrad, Steven J.
Oluwayinka, Eniope B.
Heidari, Mohammad
Mays, Jody K.
Dunn, John R.
author_facet Conrad, Steven J.
Oluwayinka, Eniope B.
Heidari, Mohammad
Mays, Jody K.
Dunn, John R.
author_sort Conrad, Steven J.
collection PubMed
description Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic serotypes of MDV (GaHV-3), or non-pathogenic strains of the related Melagrid alphaherpesvirus 1 (MeHV-1). One attractive strategy for the production of new vaccine strains is a recombinant MDV attenuated by the deletion of the major viral oncogene meq. However, meq-deleted variants of MDV cause atrophy of the bursa and thymus in maternal antibody-negative chickens, and the resulting immunosuppression makes them unsuitable. Herein we detail our attempt to mitigate the lymphoid atrophy caused by meq-deleted MDV by further attenuation of the virus through ablation of the viral thymidine kinase (tk) gene. We demonstrate that ablation of the viral tk from the meq-deleted virus rMd5B40/Δmeq resulted in a virus attenuated for replication in vitro and which spared chickens from atrophy of the lymphoid organs in vivo. When the rMd5B40/Δmeq/Δtk/GFP was used as a vaccine it was protective against challenge with the vv+MDV strain 686, but the protection was less than that provided by the CVI988/Rispens vaccine.
format Online
Article
Text
id pubmed-8779792
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-87797922022-01-22 Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective Conrad, Steven J. Oluwayinka, Eniope B. Heidari, Mohammad Mays, Jody K. Dunn, John R. Microorganisms Article Marek’s disease (MD) is a ubiquitous disease of domesticated chickens and its etiologic agent is the Gallid alphaherpesvirus 2 (GaHV-2), also known as Marek’s disease virus (MDV). MD is currently controlled by vaccination using live attenuated strains of MDV (e.g., CVI988/Rispens), non-pathogenic serotypes of MDV (GaHV-3), or non-pathogenic strains of the related Melagrid alphaherpesvirus 1 (MeHV-1). One attractive strategy for the production of new vaccine strains is a recombinant MDV attenuated by the deletion of the major viral oncogene meq. However, meq-deleted variants of MDV cause atrophy of the bursa and thymus in maternal antibody-negative chickens, and the resulting immunosuppression makes them unsuitable. Herein we detail our attempt to mitigate the lymphoid atrophy caused by meq-deleted MDV by further attenuation of the virus through ablation of the viral thymidine kinase (tk) gene. We demonstrate that ablation of the viral tk from the meq-deleted virus rMd5B40/Δmeq resulted in a virus attenuated for replication in vitro and which spared chickens from atrophy of the lymphoid organs in vivo. When the rMd5B40/Δmeq/Δtk/GFP was used as a vaccine it was protective against challenge with the vv+MDV strain 686, but the protection was less than that provided by the CVI988/Rispens vaccine. MDPI 2021-12-22 /pmc/articles/PMC8779792/ /pubmed/35056456 http://dx.doi.org/10.3390/microorganisms10010007 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Conrad, Steven J.
Oluwayinka, Eniope B.
Heidari, Mohammad
Mays, Jody K.
Dunn, John R.
Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title_full Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title_fullStr Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title_full_unstemmed Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title_short Deletion of the Viral Thymidine Kinase in a Meq-Deleted Recombinant Marek’s Disease Virus Reduces Lymphoid Atrophy but Is Less Protective
title_sort deletion of the viral thymidine kinase in a meq-deleted recombinant marek’s disease virus reduces lymphoid atrophy but is less protective
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8779792/
https://www.ncbi.nlm.nih.gov/pubmed/35056456
http://dx.doi.org/10.3390/microorganisms10010007
work_keys_str_mv AT conradstevenj deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective
AT oluwayinkaeniopeb deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective
AT heidarimohammad deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective
AT maysjodyk deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective
AT dunnjohnr deletionoftheviralthymidinekinaseinameqdeletedrecombinantmareksdiseasevirusreduceslymphoidatrophybutislessprotective