Cargando…
Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
S. Karger AG
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8787560/ https://www.ncbi.nlm.nih.gov/pubmed/35111031 http://dx.doi.org/10.1159/000521245 |
_version_ | 1784639386722238464 |
---|---|
author | Taguchi, Meari Bonner, Kyle Memon, Anza Bilal |
author_facet | Taguchi, Meari Bonner, Kyle Memon, Anza Bilal |
author_sort | Taguchi, Meari |
collection | PubMed |
description | Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of presentation. Lumbar puncture showed albuminocytological dissociation, and electrophysiology showed features of demyelination with secondary axon loss. In the published literature on GBS associated with COVID-19, almost all patients presented with neurological symptoms 1–4 weeks after the infection. GBS can be an early or late manifestation after COVID-19. Patients with signs of paraparesis and facial weakness after COVID-19 should be carefully evaluated for immune-mediated central and peripheral nervous system disorders. |
format | Online Article Text |
id | pubmed-8787560 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | S. Karger AG |
record_format | MEDLINE/PubMed |
spelling | pubmed-87875602022-02-01 Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection Taguchi, Meari Bonner, Kyle Memon, Anza Bilal Case Rep Neurol Single Case – General Neurology Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of presentation. Lumbar puncture showed albuminocytological dissociation, and electrophysiology showed features of demyelination with secondary axon loss. In the published literature on GBS associated with COVID-19, almost all patients presented with neurological symptoms 1–4 weeks after the infection. GBS can be an early or late manifestation after COVID-19. Patients with signs of paraparesis and facial weakness after COVID-19 should be carefully evaluated for immune-mediated central and peripheral nervous system disorders. S. Karger AG 2022-01-18 /pmc/articles/PMC8787560/ /pubmed/35111031 http://dx.doi.org/10.1159/000521245 Text en Copyright © 2022 by The Author(s). Published by S. Karger AG, Basel https://creativecommons.org/licenses/by-nc/4.0/This article is licensed under the Creative Commons Attribution-NonCommercial-4.0 International License (CC BY-NC) (http://www.karger.com/Services/OpenAccessLicense). Usage and distribution for commercial purposes requires written permission. |
spellingShingle | Single Case – General Neurology Taguchi, Meari Bonner, Kyle Memon, Anza Bilal Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title | Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title_full | Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title_fullStr | Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title_full_unstemmed | Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title_short | Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection |
title_sort | late-onset guillain-barré syndrome and right facial nerve palsy after covid-19 infection |
topic | Single Case – General Neurology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8787560/ https://www.ncbi.nlm.nih.gov/pubmed/35111031 http://dx.doi.org/10.1159/000521245 |
work_keys_str_mv | AT taguchimeari lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection AT bonnerkyle lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection AT memonanzabilal lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection |