Cargando…

Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection

Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of...

Descripción completa

Detalles Bibliográficos
Autores principales: Taguchi, Meari, Bonner, Kyle, Memon, Anza Bilal
Formato: Online Artículo Texto
Lenguaje:English
Publicado: S. Karger AG 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8787560/
https://www.ncbi.nlm.nih.gov/pubmed/35111031
http://dx.doi.org/10.1159/000521245
_version_ 1784639386722238464
author Taguchi, Meari
Bonner, Kyle
Memon, Anza Bilal
author_facet Taguchi, Meari
Bonner, Kyle
Memon, Anza Bilal
author_sort Taguchi, Meari
collection PubMed
description Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of presentation. Lumbar puncture showed albuminocytological dissociation, and electrophysiology showed features of demyelination with secondary axon loss. In the published literature on GBS associated with COVID-19, almost all patients presented with neurological symptoms 1–4 weeks after the infection. GBS can be an early or late manifestation after COVID-19. Patients with signs of paraparesis and facial weakness after COVID-19 should be carefully evaluated for immune-mediated central and peripheral nervous system disorders.
format Online
Article
Text
id pubmed-8787560
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher S. Karger AG
record_format MEDLINE/PubMed
spelling pubmed-87875602022-02-01 Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection Taguchi, Meari Bonner, Kyle Memon, Anza Bilal Case Rep Neurol Single Case – General Neurology Here, we present a case of late-onset Guillain-Barré syndrome (GBS) associated with COVID-19. A 70-year-old woman presented with ascending paralysis and right lower motor neuron facial weakness 2 months after COVID-19 infection. Test results for SARS-CoV-2 immunoglobulin were positive at the time of presentation. Lumbar puncture showed albuminocytological dissociation, and electrophysiology showed features of demyelination with secondary axon loss. In the published literature on GBS associated with COVID-19, almost all patients presented with neurological symptoms 1–4 weeks after the infection. GBS can be an early or late manifestation after COVID-19. Patients with signs of paraparesis and facial weakness after COVID-19 should be carefully evaluated for immune-mediated central and peripheral nervous system disorders. S. Karger AG 2022-01-18 /pmc/articles/PMC8787560/ /pubmed/35111031 http://dx.doi.org/10.1159/000521245 Text en Copyright © 2022 by The Author(s). Published by S. Karger AG, Basel https://creativecommons.org/licenses/by-nc/4.0/This article is licensed under the Creative Commons Attribution-NonCommercial-4.0 International License (CC BY-NC) (http://www.karger.com/Services/OpenAccessLicense). Usage and distribution for commercial purposes requires written permission.
spellingShingle Single Case – General Neurology
Taguchi, Meari
Bonner, Kyle
Memon, Anza Bilal
Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title_full Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title_fullStr Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title_full_unstemmed Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title_short Late-Onset Guillain-Barré Syndrome and Right Facial Nerve Palsy after COVID-19 Infection
title_sort late-onset guillain-barré syndrome and right facial nerve palsy after covid-19 infection
topic Single Case – General Neurology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8787560/
https://www.ncbi.nlm.nih.gov/pubmed/35111031
http://dx.doi.org/10.1159/000521245
work_keys_str_mv AT taguchimeari lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection
AT bonnerkyle lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection
AT memonanzabilal lateonsetguillainbarresyndromeandrightfacialnervepalsyaftercovid19infection