Cargando…

Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol

BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the devel...

Descripción completa

Detalles Bibliográficos
Autores principales: Will, Patrick A., Wan, Zhenzhen, Seide, Svenja E., Berner, Juan Enrique, Kneser, Ulrich, Gazyakan, Emre, Hirche, Christoph
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8805248/
https://www.ncbi.nlm.nih.gov/pubmed/35105375
http://dx.doi.org/10.1186/s13643-022-01885-9
_version_ 1784643204586405888
author Will, Patrick A.
Wan, Zhenzhen
Seide, Svenja E.
Berner, Juan Enrique
Kneser, Ulrich
Gazyakan, Emre
Hirche, Christoph
author_facet Will, Patrick A.
Wan, Zhenzhen
Seide, Svenja E.
Berner, Juan Enrique
Kneser, Ulrich
Gazyakan, Emre
Hirche, Christoph
author_sort Will, Patrick A.
collection PubMed
description BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the development of supermicrosurgery, such as vascularized lymph node transfer (VLNT) and lymphovenous anastomosis LVA, the indications and outcomes of these complex groups of interventions remain a controversial topic in the field of reconstructive plastic surgery. METHODS: This systematic review and network meta-analysis aims to assess the evidence of outcomes of LVA and VLNT in patients with lymphedema. Secondary aims of the project are to determine if for any outcomes, LVA or VLNT is superior to conservative therapy alone, and whether the available evidence favors any kind of supermicrosurgical interventions for lymphedema patients. This study will include original studies of patients with lymphedema on the extremities indexed in PubMed, EMBASE, CENTRAL, PASCAL, FRANCIS, ISTEX, LILACS, CNKI, and IndMED that reported microsurgery (supermicrosurgery) of all techniques aiming the re-functionalization of the lymphatic system. As comparators, mere observation, conservative treatment of any kind, and the other subgroups of supermicrosurgery are planned. The primary outcome of this systematic review and network meta-analysis is the difference of the limb volume, while the secondary outcomes of interest will be erysipelas rates, major and minor complications, postoperative necessity of continuous compression garments, and patient satisfaction, measured by already published and validated scores for quality of life. DISCUSSION: We will provide an overview and evidence grade analysis of the scientific literature available on the effectiveness of the subcategories of supermicrosurgical interventions for lymphedema. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01885-9.
format Online
Article
Text
id pubmed-8805248
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-88052482022-02-03 Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol Will, Patrick A. Wan, Zhenzhen Seide, Svenja E. Berner, Juan Enrique Kneser, Ulrich Gazyakan, Emre Hirche, Christoph Syst Rev Protocol BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the development of supermicrosurgery, such as vascularized lymph node transfer (VLNT) and lymphovenous anastomosis LVA, the indications and outcomes of these complex groups of interventions remain a controversial topic in the field of reconstructive plastic surgery. METHODS: This systematic review and network meta-analysis aims to assess the evidence of outcomes of LVA and VLNT in patients with lymphedema. Secondary aims of the project are to determine if for any outcomes, LVA or VLNT is superior to conservative therapy alone, and whether the available evidence favors any kind of supermicrosurgical interventions for lymphedema patients. This study will include original studies of patients with lymphedema on the extremities indexed in PubMed, EMBASE, CENTRAL, PASCAL, FRANCIS, ISTEX, LILACS, CNKI, and IndMED that reported microsurgery (supermicrosurgery) of all techniques aiming the re-functionalization of the lymphatic system. As comparators, mere observation, conservative treatment of any kind, and the other subgroups of supermicrosurgery are planned. The primary outcome of this systematic review and network meta-analysis is the difference of the limb volume, while the secondary outcomes of interest will be erysipelas rates, major and minor complications, postoperative necessity of continuous compression garments, and patient satisfaction, measured by already published and validated scores for quality of life. DISCUSSION: We will provide an overview and evidence grade analysis of the scientific literature available on the effectiveness of the subcategories of supermicrosurgical interventions for lymphedema. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01885-9. BioMed Central 2022-02-01 /pmc/articles/PMC8805248/ /pubmed/35105375 http://dx.doi.org/10.1186/s13643-022-01885-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Protocol
Will, Patrick A.
Wan, Zhenzhen
Seide, Svenja E.
Berner, Juan Enrique
Kneser, Ulrich
Gazyakan, Emre
Hirche, Christoph
Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title_full Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title_fullStr Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title_full_unstemmed Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title_short Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
title_sort supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8805248/
https://www.ncbi.nlm.nih.gov/pubmed/35105375
http://dx.doi.org/10.1186/s13643-022-01885-9
work_keys_str_mv AT willpatricka supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT wanzhenzhen supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT seidesvenjae supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT bernerjuanenrique supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT kneserulrich supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT gazyakanemre supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol
AT hirchechristoph supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol