Cargando…
Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol
BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the devel...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8805248/ https://www.ncbi.nlm.nih.gov/pubmed/35105375 http://dx.doi.org/10.1186/s13643-022-01885-9 |
_version_ | 1784643204586405888 |
---|---|
author | Will, Patrick A. Wan, Zhenzhen Seide, Svenja E. Berner, Juan Enrique Kneser, Ulrich Gazyakan, Emre Hirche, Christoph |
author_facet | Will, Patrick A. Wan, Zhenzhen Seide, Svenja E. Berner, Juan Enrique Kneser, Ulrich Gazyakan, Emre Hirche, Christoph |
author_sort | Will, Patrick A. |
collection | PubMed |
description | BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the development of supermicrosurgery, such as vascularized lymph node transfer (VLNT) and lymphovenous anastomosis LVA, the indications and outcomes of these complex groups of interventions remain a controversial topic in the field of reconstructive plastic surgery. METHODS: This systematic review and network meta-analysis aims to assess the evidence of outcomes of LVA and VLNT in patients with lymphedema. Secondary aims of the project are to determine if for any outcomes, LVA or VLNT is superior to conservative therapy alone, and whether the available evidence favors any kind of supermicrosurgical interventions for lymphedema patients. This study will include original studies of patients with lymphedema on the extremities indexed in PubMed, EMBASE, CENTRAL, PASCAL, FRANCIS, ISTEX, LILACS, CNKI, and IndMED that reported microsurgery (supermicrosurgery) of all techniques aiming the re-functionalization of the lymphatic system. As comparators, mere observation, conservative treatment of any kind, and the other subgroups of supermicrosurgery are planned. The primary outcome of this systematic review and network meta-analysis is the difference of the limb volume, while the secondary outcomes of interest will be erysipelas rates, major and minor complications, postoperative necessity of continuous compression garments, and patient satisfaction, measured by already published and validated scores for quality of life. DISCUSSION: We will provide an overview and evidence grade analysis of the scientific literature available on the effectiveness of the subcategories of supermicrosurgical interventions for lymphedema. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01885-9. |
format | Online Article Text |
id | pubmed-8805248 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-88052482022-02-03 Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol Will, Patrick A. Wan, Zhenzhen Seide, Svenja E. Berner, Juan Enrique Kneser, Ulrich Gazyakan, Emre Hirche, Christoph Syst Rev Protocol BACKGROUND: Lymphedema is a condition that affects up to 130 million subjects worldwide. Since it is related to several complications and a significant reduction in terms of quality of life, it is a heavy burden not only to the patients but also for the healthcare system worldwide. Despite the development of supermicrosurgery, such as vascularized lymph node transfer (VLNT) and lymphovenous anastomosis LVA, the indications and outcomes of these complex groups of interventions remain a controversial topic in the field of reconstructive plastic surgery. METHODS: This systematic review and network meta-analysis aims to assess the evidence of outcomes of LVA and VLNT in patients with lymphedema. Secondary aims of the project are to determine if for any outcomes, LVA or VLNT is superior to conservative therapy alone, and whether the available evidence favors any kind of supermicrosurgical interventions for lymphedema patients. This study will include original studies of patients with lymphedema on the extremities indexed in PubMed, EMBASE, CENTRAL, PASCAL, FRANCIS, ISTEX, LILACS, CNKI, and IndMED that reported microsurgery (supermicrosurgery) of all techniques aiming the re-functionalization of the lymphatic system. As comparators, mere observation, conservative treatment of any kind, and the other subgroups of supermicrosurgery are planned. The primary outcome of this systematic review and network meta-analysis is the difference of the limb volume, while the secondary outcomes of interest will be erysipelas rates, major and minor complications, postoperative necessity of continuous compression garments, and patient satisfaction, measured by already published and validated scores for quality of life. DISCUSSION: We will provide an overview and evidence grade analysis of the scientific literature available on the effectiveness of the subcategories of supermicrosurgical interventions for lymphedema. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01885-9. BioMed Central 2022-02-01 /pmc/articles/PMC8805248/ /pubmed/35105375 http://dx.doi.org/10.1186/s13643-022-01885-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Will, Patrick A. Wan, Zhenzhen Seide, Svenja E. Berner, Juan Enrique Kneser, Ulrich Gazyakan, Emre Hirche, Christoph Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title | Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title_full | Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title_fullStr | Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title_full_unstemmed | Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title_short | Supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
title_sort | supermicrosurgical treatment for lymphedema: a systematic review and network meta-analysis protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8805248/ https://www.ncbi.nlm.nih.gov/pubmed/35105375 http://dx.doi.org/10.1186/s13643-022-01885-9 |
work_keys_str_mv | AT willpatricka supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT wanzhenzhen supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT seidesvenjae supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT bernerjuanenrique supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT kneserulrich supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT gazyakanemre supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol AT hirchechristoph supermicrosurgicaltreatmentforlymphedemaasystematicreviewandnetworkmetaanalysisprotocol |