Cargando…

miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)

To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the lev...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Hong, Jia, Xiaofeng, Yang, Fan, Shi, Pengfei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8806774/
https://www.ncbi.nlm.nih.gov/pubmed/34308752
http://dx.doi.org/10.1080/21655979.2021.1956400
_version_ 1784643534620459008
author Zhou, Hong
Jia, Xiaofeng
Yang, Fan
Shi, Pengfei
author_facet Zhou, Hong
Jia, Xiaofeng
Yang, Fan
Shi, Pengfei
author_sort Zhou, Hong
collection PubMed
description To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the level was lower in AML cells, especially in J111 and KG-1a cells. In J111 and KG-1a cells, the up-regulation of miR-148a-3p mimics blocked the cell growth by arresting cell cycle at G2/M and enhancing cell apoptosis. Transwell and EMT markers detection indicated that miR-148a-3p reduced the cell migration and invasion. Afterward, through bioinformatics analysis, it showed that the CDK6 is one of the direct target genes of miR-148a-3p. DLR assay confirmed the target regulation. CDK6 overexpression reversed the effects of miR-148a-3p on AML cells. Collectively, miR-148a-3p inhibited the process of AML cells through disturbing the CDK-6 expression, implying that the trageting miR-148a-3p might be regarded as effective therapy of AML.
format Online
Article
Text
id pubmed-8806774
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-88067742022-02-02 miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) Zhou, Hong Jia, Xiaofeng Yang, Fan Shi, Pengfei Bioengineered Research Paper To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the level was lower in AML cells, especially in J111 and KG-1a cells. In J111 and KG-1a cells, the up-regulation of miR-148a-3p mimics blocked the cell growth by arresting cell cycle at G2/M and enhancing cell apoptosis. Transwell and EMT markers detection indicated that miR-148a-3p reduced the cell migration and invasion. Afterward, through bioinformatics analysis, it showed that the CDK6 is one of the direct target genes of miR-148a-3p. DLR assay confirmed the target regulation. CDK6 overexpression reversed the effects of miR-148a-3p on AML cells. Collectively, miR-148a-3p inhibited the process of AML cells through disturbing the CDK-6 expression, implying that the trageting miR-148a-3p might be regarded as effective therapy of AML. Taylor & Francis 2021-07-24 /pmc/articles/PMC8806774/ /pubmed/34308752 http://dx.doi.org/10.1080/21655979.2021.1956400 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) ), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Paper
Zhou, Hong
Jia, Xiaofeng
Yang, Fan
Shi, Pengfei
miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title_full miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title_fullStr miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title_full_unstemmed miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title_short miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
title_sort mir-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (cdk6)
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8806774/
https://www.ncbi.nlm.nih.gov/pubmed/34308752
http://dx.doi.org/10.1080/21655979.2021.1956400
work_keys_str_mv AT zhouhong mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6
AT jiaxiaofeng mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6
AT yangfan mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6
AT shipengfei mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6