Cargando…
miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6)
To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the lev...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8806774/ https://www.ncbi.nlm.nih.gov/pubmed/34308752 http://dx.doi.org/10.1080/21655979.2021.1956400 |
_version_ | 1784643534620459008 |
---|---|
author | Zhou, Hong Jia, Xiaofeng Yang, Fan Shi, Pengfei |
author_facet | Zhou, Hong Jia, Xiaofeng Yang, Fan Shi, Pengfei |
author_sort | Zhou, Hong |
collection | PubMed |
description | To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the level was lower in AML cells, especially in J111 and KG-1a cells. In J111 and KG-1a cells, the up-regulation of miR-148a-3p mimics blocked the cell growth by arresting cell cycle at G2/M and enhancing cell apoptosis. Transwell and EMT markers detection indicated that miR-148a-3p reduced the cell migration and invasion. Afterward, through bioinformatics analysis, it showed that the CDK6 is one of the direct target genes of miR-148a-3p. DLR assay confirmed the target regulation. CDK6 overexpression reversed the effects of miR-148a-3p on AML cells. Collectively, miR-148a-3p inhibited the process of AML cells through disturbing the CDK-6 expression, implying that the trageting miR-148a-3p might be regarded as effective therapy of AML. |
format | Online Article Text |
id | pubmed-8806774 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-88067742022-02-02 miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) Zhou, Hong Jia, Xiaofeng Yang, Fan Shi, Pengfei Bioengineered Research Paper To study the regulation of miR-148a-3p on CDK6 and its mechanism in the progress of acute myeloid leukemia (AML), differential miRNAs were analyzed by bioinformatics, and the miR-148a-3p levels in AML cell lines were detected. Results showed that miR-148a-3p played a crucial role in AML, and the level was lower in AML cells, especially in J111 and KG-1a cells. In J111 and KG-1a cells, the up-regulation of miR-148a-3p mimics blocked the cell growth by arresting cell cycle at G2/M and enhancing cell apoptosis. Transwell and EMT markers detection indicated that miR-148a-3p reduced the cell migration and invasion. Afterward, through bioinformatics analysis, it showed that the CDK6 is one of the direct target genes of miR-148a-3p. DLR assay confirmed the target regulation. CDK6 overexpression reversed the effects of miR-148a-3p on AML cells. Collectively, miR-148a-3p inhibited the process of AML cells through disturbing the CDK-6 expression, implying that the trageting miR-148a-3p might be regarded as effective therapy of AML. Taylor & Francis 2021-07-24 /pmc/articles/PMC8806774/ /pubmed/34308752 http://dx.doi.org/10.1080/21655979.2021.1956400 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) ), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Paper Zhou, Hong Jia, Xiaofeng Yang, Fan Shi, Pengfei miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title | miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title_full | miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title_fullStr | miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title_full_unstemmed | miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title_short | miR-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (CDK6) |
title_sort | mir-148a-3p suppresses the progression of acute myeloid leukemia via targeting cyclin-dependent kinase 6 (cdk6) |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8806774/ https://www.ncbi.nlm.nih.gov/pubmed/34308752 http://dx.doi.org/10.1080/21655979.2021.1956400 |
work_keys_str_mv | AT zhouhong mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6 AT jiaxiaofeng mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6 AT yangfan mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6 AT shipengfei mir148a3psuppressestheprogressionofacutemyeloidleukemiaviatargetingcyclindependentkinase6cdk6 |