Cargando…
Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression
Lipopolysaccharide binding protein (Lbp) has been recently identified as a relevant component of innate immunity response associated to adiposity. Here, we aimed to investigate the impact of adipose tissue Lbp on weight gain and white adipose tissue (WAT) in male and female mice fed an obesogenic di...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society of Gene & Cell Therapy
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8807983/ https://www.ncbi.nlm.nih.gov/pubmed/35141047 http://dx.doi.org/10.1016/j.omtn.2022.01.002 |
_version_ | 1784643785041379328 |
---|---|
author | Latorre, Jessica Ortega, Francisco Oliveras-Cañellas, Núria Comas, Ferran Lluch, Aina Gavaldà-Navarro, Aleix Morón-Ros, Samantha Ricart, Wifredo Villarroya, Francesc Giralt, Marta Fernández-Real, José Manuel Moreno-Navarrete, José María |
author_facet | Latorre, Jessica Ortega, Francisco Oliveras-Cañellas, Núria Comas, Ferran Lluch, Aina Gavaldà-Navarro, Aleix Morón-Ros, Samantha Ricart, Wifredo Villarroya, Francesc Giralt, Marta Fernández-Real, José Manuel Moreno-Navarrete, José María |
author_sort | Latorre, Jessica |
collection | PubMed |
description | Lipopolysaccharide binding protein (Lbp) has been recently identified as a relevant component of innate immunity response associated to adiposity. Here, we aimed to investigate the impact of adipose tissue Lbp on weight gain and white adipose tissue (WAT) in male and female mice fed an obesogenic diet. Specific adipose tissue Lbp gene knockdown was achieved through lentiviral particles containing shRNA-Lbp injected through surgery intervention. In males, WAT Lbp mRNA levels increased in parallel to fat accretion, and specific WAT Lbp gene knockdown led to reduced body weight gain, decreased fat accretion-related gene and protein expression, and increased inguinal WAT basal lipase activity, in parallel to lowered plasma free fatty acids, leptin, triglycerides but higher glycerol levels, resulting in slightly improved insulin action in the insulin tolerance test. In both males and females, inguinal WAT Lbp gene knockdown resulted in increased Ucp1 and Ppargc1a mRNA and Ucp1 protein levels, confirming adipose Lbp as a WAT browning repressor. In perigonadal WAT, Lbp gene knockdown also resulted in increased Ucp1 mRNA levels, but only in female mice, in which it was 500-fold increased. These data suggest specific adipose tissue Lbp gene knockdown as a possible therapeutic approach in the prevention of obesity-associated fat accretion. |
format | Online Article Text |
id | pubmed-8807983 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | American Society of Gene & Cell Therapy |
record_format | MEDLINE/PubMed |
spelling | pubmed-88079832022-02-08 Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression Latorre, Jessica Ortega, Francisco Oliveras-Cañellas, Núria Comas, Ferran Lluch, Aina Gavaldà-Navarro, Aleix Morón-Ros, Samantha Ricart, Wifredo Villarroya, Francesc Giralt, Marta Fernández-Real, José Manuel Moreno-Navarrete, José María Mol Ther Nucleic Acids Original Article Lipopolysaccharide binding protein (Lbp) has been recently identified as a relevant component of innate immunity response associated to adiposity. Here, we aimed to investigate the impact of adipose tissue Lbp on weight gain and white adipose tissue (WAT) in male and female mice fed an obesogenic diet. Specific adipose tissue Lbp gene knockdown was achieved through lentiviral particles containing shRNA-Lbp injected through surgery intervention. In males, WAT Lbp mRNA levels increased in parallel to fat accretion, and specific WAT Lbp gene knockdown led to reduced body weight gain, decreased fat accretion-related gene and protein expression, and increased inguinal WAT basal lipase activity, in parallel to lowered plasma free fatty acids, leptin, triglycerides but higher glycerol levels, resulting in slightly improved insulin action in the insulin tolerance test. In both males and females, inguinal WAT Lbp gene knockdown resulted in increased Ucp1 and Ppargc1a mRNA and Ucp1 protein levels, confirming adipose Lbp as a WAT browning repressor. In perigonadal WAT, Lbp gene knockdown also resulted in increased Ucp1 mRNA levels, but only in female mice, in which it was 500-fold increased. These data suggest specific adipose tissue Lbp gene knockdown as a possible therapeutic approach in the prevention of obesity-associated fat accretion. American Society of Gene & Cell Therapy 2022-01-10 /pmc/articles/PMC8807983/ /pubmed/35141047 http://dx.doi.org/10.1016/j.omtn.2022.01.002 Text en © 2022 The Author(s) https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Original Article Latorre, Jessica Ortega, Francisco Oliveras-Cañellas, Núria Comas, Ferran Lluch, Aina Gavaldà-Navarro, Aleix Morón-Ros, Samantha Ricart, Wifredo Villarroya, Francesc Giralt, Marta Fernández-Real, José Manuel Moreno-Navarrete, José María Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title | Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title_full | Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title_fullStr | Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title_full_unstemmed | Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title_short | Specific adipose tissue Lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
title_sort | specific adipose tissue lbp gene knockdown prevents diet-induced body weight gain, impacting fat accretion-related gene and protein expression |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8807983/ https://www.ncbi.nlm.nih.gov/pubmed/35141047 http://dx.doi.org/10.1016/j.omtn.2022.01.002 |
work_keys_str_mv | AT latorrejessica specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT ortegafrancisco specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT oliverascanellasnuria specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT comasferran specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT lluchaina specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT gavaldanavarroaleix specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT moronrossamantha specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT ricartwifredo specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT villarroyafrancesc specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT giraltmarta specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT fernandezrealjosemanuel specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression AT morenonavarretejosemaria specificadiposetissuelbpgeneknockdownpreventsdietinducedbodyweightgainimpactingfataccretionrelatedgeneandproteinexpression |