Cargando…

Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up

BACKGROUND: The infestation with Echinococcus multilocularis larvae may persist in humans for up to decades without evident clinical symptoms. Longitudinal investigations are needed to understand the dynamic immunological processes in alveolar echinococcosis (AE) patients associated with an active a...

Descripción completa

Detalles Bibliográficos
Autores principales: Grüner, Beate, Peters, Lynn, Hillenbrand, Andreas, Voßberg, Patrick, Schweiker, Jonas, Rollmann, Elisabeth G., Rodriguez, Laura H., Blumhardt, Jasmin, Burkert, Sanne, Kern, Peter, Köhler, Carsten, Soboslay, Peter T.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8809567/
https://www.ncbi.nlm.nih.gov/pubmed/35108275
http://dx.doi.org/10.1371/journal.pntd.0010099
_version_ 1784644044706545664
author Grüner, Beate
Peters, Lynn
Hillenbrand, Andreas
Voßberg, Patrick
Schweiker, Jonas
Rollmann, Elisabeth G.
Rodriguez, Laura H.
Blumhardt, Jasmin
Burkert, Sanne
Kern, Peter
Köhler, Carsten
Soboslay, Peter T.
author_facet Grüner, Beate
Peters, Lynn
Hillenbrand, Andreas
Voßberg, Patrick
Schweiker, Jonas
Rollmann, Elisabeth G.
Rodriguez, Laura H.
Blumhardt, Jasmin
Burkert, Sanne
Kern, Peter
Köhler, Carsten
Soboslay, Peter T.
author_sort Grüner, Beate
collection PubMed
description BACKGROUND: The infestation with Echinococcus multilocularis larvae may persist in humans for up to decades without evident clinical symptoms. Longitudinal investigations are needed to understand the dynamic immunological processes in alveolar echinococcosis (AE) patients associated with an active and progressive, a stable or a regressive course of disease. METHODOLOGY/PRINCIPAL FINDINGS: This study evaluated the E. multilocularis specific antibody responses, systemic cytokine, and chemokine serum levels over a 10-year follow-up period, as well as cellular responsiveness in AE patients. Our results demonstrate a rapid decrease in antibodies against E. multilocularis specific antigen Em2+. Especially in cured patients, these antibodies remained negative, making them a significant predictor for cured AE. E. multilocularis specific IgG4, and indirect hemagglutination IHA decreased later in time, after around 5 years. While total IgE did not show significant dynamics over the course of disease, E. multilocularis specific IgE decreased after one to two years, and increasing levels were a significant predictor of progressive disease. There was no significant change in systemic IL-8, IL-9, CCL18 or CCL20 serum levels over time. Univariate analysis across groups indicated lower IL-8 levels in cured patients; however, this result could not be confirmed by multivariate analysis. Levels of CCL17 decreased during treatment, especially in cured patients, and thus might serve as a predictive or risk factor for progressive disease. Levels of IL-10 and CCL13 decreased during disease, especially after five and ten years of intervention. The E. multilocularis antigen (EmAg) inducible cellular productions of MCP1(CCL13), TARC(CCL17) and PARC(CCL18) were lowest in patients with cured AE and infection-free controls, while the EmAg inducible cellular production of IFN-γ increased after cure. Significant positive cytokine and chemokine correlations were observed in AE patients for IL-9, IL-10, CCL13(MCP-4), CCL17(TARC) and CCL20(LARC)(for all p<0.001). E. multilocularis specific IgG4 response correlated positively with TARC (p<0.001). Both markers enhanced over time in progressive disease and decreased after cure. The levels of IL-8, IL-10, MCP4 and LARC enhanced with AE regression. CONCLUSIONS/SIGNIFICANCE: Repeated biomarker surveys are advisable to evaluate progression or regression of disease during longitudinal follow-up and such analyses can support imaging techniques and improve staging of AE patients.
format Online
Article
Text
id pubmed-8809567
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-88095672022-02-03 Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up Grüner, Beate Peters, Lynn Hillenbrand, Andreas Voßberg, Patrick Schweiker, Jonas Rollmann, Elisabeth G. Rodriguez, Laura H. Blumhardt, Jasmin Burkert, Sanne Kern, Peter Köhler, Carsten Soboslay, Peter T. PLoS Negl Trop Dis Research Article BACKGROUND: The infestation with Echinococcus multilocularis larvae may persist in humans for up to decades without evident clinical symptoms. Longitudinal investigations are needed to understand the dynamic immunological processes in alveolar echinococcosis (AE) patients associated with an active and progressive, a stable or a regressive course of disease. METHODOLOGY/PRINCIPAL FINDINGS: This study evaluated the E. multilocularis specific antibody responses, systemic cytokine, and chemokine serum levels over a 10-year follow-up period, as well as cellular responsiveness in AE patients. Our results demonstrate a rapid decrease in antibodies against E. multilocularis specific antigen Em2+. Especially in cured patients, these antibodies remained negative, making them a significant predictor for cured AE. E. multilocularis specific IgG4, and indirect hemagglutination IHA decreased later in time, after around 5 years. While total IgE did not show significant dynamics over the course of disease, E. multilocularis specific IgE decreased after one to two years, and increasing levels were a significant predictor of progressive disease. There was no significant change in systemic IL-8, IL-9, CCL18 or CCL20 serum levels over time. Univariate analysis across groups indicated lower IL-8 levels in cured patients; however, this result could not be confirmed by multivariate analysis. Levels of CCL17 decreased during treatment, especially in cured patients, and thus might serve as a predictive or risk factor for progressive disease. Levels of IL-10 and CCL13 decreased during disease, especially after five and ten years of intervention. The E. multilocularis antigen (EmAg) inducible cellular productions of MCP1(CCL13), TARC(CCL17) and PARC(CCL18) were lowest in patients with cured AE and infection-free controls, while the EmAg inducible cellular production of IFN-γ increased after cure. Significant positive cytokine and chemokine correlations were observed in AE patients for IL-9, IL-10, CCL13(MCP-4), CCL17(TARC) and CCL20(LARC)(for all p<0.001). E. multilocularis specific IgG4 response correlated positively with TARC (p<0.001). Both markers enhanced over time in progressive disease and decreased after cure. The levels of IL-8, IL-10, MCP4 and LARC enhanced with AE regression. CONCLUSIONS/SIGNIFICANCE: Repeated biomarker surveys are advisable to evaluate progression or regression of disease during longitudinal follow-up and such analyses can support imaging techniques and improve staging of AE patients. Public Library of Science 2022-02-02 /pmc/articles/PMC8809567/ /pubmed/35108275 http://dx.doi.org/10.1371/journal.pntd.0010099 Text en © 2022 Grüner et al https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Grüner, Beate
Peters, Lynn
Hillenbrand, Andreas
Voßberg, Patrick
Schweiker, Jonas
Rollmann, Elisabeth G.
Rodriguez, Laura H.
Blumhardt, Jasmin
Burkert, Sanne
Kern, Peter
Köhler, Carsten
Soboslay, Peter T.
Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title_full Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title_fullStr Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title_full_unstemmed Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title_short Echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: A 10-year follow-up
title_sort echinococcus multilocularis specific antibody, systemic cytokine, and chemokine levels, as well as antigen-specific cellular responses in patients with progressive, stable, and cured alveolar echinococcosis: a 10-year follow-up
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8809567/
https://www.ncbi.nlm.nih.gov/pubmed/35108275
http://dx.doi.org/10.1371/journal.pntd.0010099
work_keys_str_mv AT grunerbeate echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT peterslynn echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT hillenbrandandreas echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT voßbergpatrick echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT schweikerjonas echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT rollmannelisabethg echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT rodriguezlaurah echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT blumhardtjasmin echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT burkertsanne echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT kernpeter echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT kohlercarsten echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup
AT soboslaypetert echinococcusmultilocularisspecificantibodysystemiccytokineandchemokinelevelsaswellasantigenspecificcellularresponsesinpatientswithprogressivestableandcuredalveolarechinococcosisa10yearfollowup