Cargando…
Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche
Rickettsia species (spp.) are strict obligate intracellular bacteria, some of which are pathogenic in their mammalian host, including humans. One critical feature of these stealthy group of pathogens is their ability to manipulate hostile cytosolic environments to their benefits. Although our unders...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society for Microbiology
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8822360/ https://www.ncbi.nlm.nih.gov/pubmed/35130729 http://dx.doi.org/10.1128/mbio.02918-21 |
_version_ | 1784646591950356480 |
---|---|
author | Voss, Oliver H. Cobb, Jennifer Gaytan, Hodalis Rivera Díaz, Natalia Sanchez, Rigoberto DeTolla, Louis Rahman, M. Sayeedur Azad, Abdu F. |
author_facet | Voss, Oliver H. Cobb, Jennifer Gaytan, Hodalis Rivera Díaz, Natalia Sanchez, Rigoberto DeTolla, Louis Rahman, M. Sayeedur Azad, Abdu F. |
author_sort | Voss, Oliver H. |
collection | PubMed |
description | Rickettsia species (spp.) are strict obligate intracellular bacteria, some of which are pathogenic in their mammalian host, including humans. One critical feature of these stealthy group of pathogens is their ability to manipulate hostile cytosolic environments to their benefits. Although our understanding of Rickettsia cell biology and pathogenesis is evolving, the mechanisms by which pathogenic Rickettsia spp. evade host innate immune detection remain elusive. Here, we show that disease severity in wild-type (WT) C57BL/6J mice infected with Rickettsia typhi (the etiologic agent of murine typhus) and Rickettsia rickettsii (the etiologic agent of Rocky Mountain spotted fever), but not with the nonpathogenic species Rickettsia montanensis, correlated with levels of bacterial burden as detected in the spleens of mice, as well as the serum concentrations of proinflammatory cytokine interleukin-1α (IL-1α) and, to a lesser extent, IL-1β. Antibody-mediated neutralization of IL-1α confirmed a key role in controlling mortality rates and bacterial burdens of rickettsia-infected WT mice. As macrophages are a primary source of both IL-1α and IL-1β cytokines, we determined the mechanism of the antirickettsial activities using bone marrow-derived macrophages. We found that pathogenic R. typhi and R. rickettsii, but not nonpathogenic R. montanensis, eluded pro-IL-1α induction and benefited predominantly from the reduced IL-1α secretion, via a caspase-11–gasdermin D (Gsdmd)-dependent pathway, to facilitate intracytosolic replication. Adoptive transfer experiments identified that IL-1α secretion by macrophages was critical for controlling rickettsiosis in WT mice. In sum, we identified a previously unappreciated pathway by which pathogenic, unlike nonpathogenic, rickettsiae preferentially target the caspase-11–Gsdmd–IL-1α signaling axis in macrophages, thus supporting their replication within the host. |
format | Online Article Text |
id | pubmed-8822360 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | American Society for Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-88223602022-02-17 Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche Voss, Oliver H. Cobb, Jennifer Gaytan, Hodalis Rivera Díaz, Natalia Sanchez, Rigoberto DeTolla, Louis Rahman, M. Sayeedur Azad, Abdu F. mBio Research Article Rickettsia species (spp.) are strict obligate intracellular bacteria, some of which are pathogenic in their mammalian host, including humans. One critical feature of these stealthy group of pathogens is their ability to manipulate hostile cytosolic environments to their benefits. Although our understanding of Rickettsia cell biology and pathogenesis is evolving, the mechanisms by which pathogenic Rickettsia spp. evade host innate immune detection remain elusive. Here, we show that disease severity in wild-type (WT) C57BL/6J mice infected with Rickettsia typhi (the etiologic agent of murine typhus) and Rickettsia rickettsii (the etiologic agent of Rocky Mountain spotted fever), but not with the nonpathogenic species Rickettsia montanensis, correlated with levels of bacterial burden as detected in the spleens of mice, as well as the serum concentrations of proinflammatory cytokine interleukin-1α (IL-1α) and, to a lesser extent, IL-1β. Antibody-mediated neutralization of IL-1α confirmed a key role in controlling mortality rates and bacterial burdens of rickettsia-infected WT mice. As macrophages are a primary source of both IL-1α and IL-1β cytokines, we determined the mechanism of the antirickettsial activities using bone marrow-derived macrophages. We found that pathogenic R. typhi and R. rickettsii, but not nonpathogenic R. montanensis, eluded pro-IL-1α induction and benefited predominantly from the reduced IL-1α secretion, via a caspase-11–gasdermin D (Gsdmd)-dependent pathway, to facilitate intracytosolic replication. Adoptive transfer experiments identified that IL-1α secretion by macrophages was critical for controlling rickettsiosis in WT mice. In sum, we identified a previously unappreciated pathway by which pathogenic, unlike nonpathogenic, rickettsiae preferentially target the caspase-11–Gsdmd–IL-1α signaling axis in macrophages, thus supporting their replication within the host. American Society for Microbiology 2022-02-08 /pmc/articles/PMC8822360/ /pubmed/35130729 http://dx.doi.org/10.1128/mbio.02918-21 Text en Copyright © 2022 Voss et al. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Research Article Voss, Oliver H. Cobb, Jennifer Gaytan, Hodalis Rivera Díaz, Natalia Sanchez, Rigoberto DeTolla, Louis Rahman, M. Sayeedur Azad, Abdu F. Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title | Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title_full | Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title_fullStr | Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title_full_unstemmed | Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title_short | Pathogenic, but Not Nonpathogenic, Rickettsia spp. Evade Inflammasome-Dependent IL-1 Responses To Establish an Intracytosolic Replication Niche |
title_sort | pathogenic, but not nonpathogenic, rickettsia spp. evade inflammasome-dependent il-1 responses to establish an intracytosolic replication niche |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8822360/ https://www.ncbi.nlm.nih.gov/pubmed/35130729 http://dx.doi.org/10.1128/mbio.02918-21 |
work_keys_str_mv | AT vossoliverh pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT cobbjennifer pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT gaytanhodalis pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT riveradiaznatalia pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT sanchezrigoberto pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT detollalouis pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT rahmanmsayeedur pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche AT azadabduf pathogenicbutnotnonpathogenicrickettsiasppevadeinflammasomedependentil1responsestoestablishanintracytosolicreplicationniche |