Cargando…
Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors
SIMPLE SUMMARY: Immune checkpoint inhibitors (ICI) are effective in fractions of patients with disseminated melanoma. Significant toxicity can also occur from the treatments, that, in addition, are expensive. It is therefore important to increase the knowledge of predictive factors and their efficac...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8833501/ https://www.ncbi.nlm.nih.gov/pubmed/35158970 http://dx.doi.org/10.3390/cancers14030702 |
_version_ | 1784648958659788800 |
---|---|
author | Costa Svedman, Fernanda Jalsenius, Marie Höiom, Veronica Grozman, Vitali Bergqvist, Mattias Söderdahl, Fabian Eriksson, Hanna Rotstein, Samuel Ny, Lars Ascierto, Paolo A. Brage, Suzanne Egyhazi Helgadottir, Hildur |
author_facet | Costa Svedman, Fernanda Jalsenius, Marie Höiom, Veronica Grozman, Vitali Bergqvist, Mattias Söderdahl, Fabian Eriksson, Hanna Rotstein, Samuel Ny, Lars Ascierto, Paolo A. Brage, Suzanne Egyhazi Helgadottir, Hildur |
author_sort | Costa Svedman, Fernanda |
collection | PubMed |
description | SIMPLE SUMMARY: Immune checkpoint inhibitors (ICI) are effective in fractions of patients with disseminated melanoma. Significant toxicity can also occur from the treatments, that, in addition, are expensive. It is therefore important to increase the knowledge of predictive factors and their efficacy in different patient groups. This study is the first to analyze the plasma activity of thymidine kinase (TK), an enzyme involved in DNA synthesis and repair, as a biomarker in melanoma patients. In this study, high TK activity (TKa) levels in melanoma patients were associated with poor baseline factors, such as poor performance status, high plasma lactate dehydrogenase levels, and advanced tumor stage. High TKa levels were also associated with a poor efficacy of immune checkpoint inhibitors. TKa is hence a novel and interesting plasma biomarker in melanoma and should be further studied to define its role as a prognostic and predictive marker in this disease. ABSTRACT: Background. Immune checkpoint inhibitors (ICI) are effective in fractions of patients with disseminated melanoma. This study is the first to analyze the plasma activity of thymidine kinase (TK), an enzyme involved in DNA synthesis and repair, as a biomarker in melanoma patients. Methods. Plasma samples were collected prior to treatment start in patients with unresectable metastatic cutaneous melanoma, treated with ICI (anti-CTLA-4 and/or anti-PD-1). Plasma TK activity (TKa) levels were determined using the DiviTum TKa ELISA assay. TKa levels were correlated with patients’ baseline characteristics, response rate (RR), progression-free survival (PFS), and overall survival (OS). Results. In the 90 study patients, the median TKa level was 42 Du/L (range <20–1787 Du/L). A significantly higher plasma TKa was found in patients with ECOG performance status ≥1 (p = 0.003), M1c-d disease (p = 0.015), and elevated lactate dehydrogenase levels (p < 0.001). The RR was 63.2% and 30.3% in those with low or high TKa, respectively (p = 0.022). The median PFS was 19.9 and 12.6 months in patients with low or high TKa, respectively (hazard ratio (HR) 1.83 (95% CI, 1.08–3.08), p = 0.024). The median OS was >60 months and 18.5 months in patients with low or high TKa, respectively (HR: 2.25 (95% CI, 1.25–4.05), p = 0.011. Conclusions. High pretreatment plasma TKa levels were significantly associated with worse baseline characteristics and poor response and survival in ICI-treated melanoma patients. TKa is hence a novel and interesting plasma biomarker in melanoma and should be further studied to define its role as a prognostic and predictive marker in this disease. |
format | Online Article Text |
id | pubmed-8833501 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-88335012022-02-12 Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors Costa Svedman, Fernanda Jalsenius, Marie Höiom, Veronica Grozman, Vitali Bergqvist, Mattias Söderdahl, Fabian Eriksson, Hanna Rotstein, Samuel Ny, Lars Ascierto, Paolo A. Brage, Suzanne Egyhazi Helgadottir, Hildur Cancers (Basel) Article SIMPLE SUMMARY: Immune checkpoint inhibitors (ICI) are effective in fractions of patients with disseminated melanoma. Significant toxicity can also occur from the treatments, that, in addition, are expensive. It is therefore important to increase the knowledge of predictive factors and their efficacy in different patient groups. This study is the first to analyze the plasma activity of thymidine kinase (TK), an enzyme involved in DNA synthesis and repair, as a biomarker in melanoma patients. In this study, high TK activity (TKa) levels in melanoma patients were associated with poor baseline factors, such as poor performance status, high plasma lactate dehydrogenase levels, and advanced tumor stage. High TKa levels were also associated with a poor efficacy of immune checkpoint inhibitors. TKa is hence a novel and interesting plasma biomarker in melanoma and should be further studied to define its role as a prognostic and predictive marker in this disease. ABSTRACT: Background. Immune checkpoint inhibitors (ICI) are effective in fractions of patients with disseminated melanoma. This study is the first to analyze the plasma activity of thymidine kinase (TK), an enzyme involved in DNA synthesis and repair, as a biomarker in melanoma patients. Methods. Plasma samples were collected prior to treatment start in patients with unresectable metastatic cutaneous melanoma, treated with ICI (anti-CTLA-4 and/or anti-PD-1). Plasma TK activity (TKa) levels were determined using the DiviTum TKa ELISA assay. TKa levels were correlated with patients’ baseline characteristics, response rate (RR), progression-free survival (PFS), and overall survival (OS). Results. In the 90 study patients, the median TKa level was 42 Du/L (range <20–1787 Du/L). A significantly higher plasma TKa was found in patients with ECOG performance status ≥1 (p = 0.003), M1c-d disease (p = 0.015), and elevated lactate dehydrogenase levels (p < 0.001). The RR was 63.2% and 30.3% in those with low or high TKa, respectively (p = 0.022). The median PFS was 19.9 and 12.6 months in patients with low or high TKa, respectively (hazard ratio (HR) 1.83 (95% CI, 1.08–3.08), p = 0.024). The median OS was >60 months and 18.5 months in patients with low or high TKa, respectively (HR: 2.25 (95% CI, 1.25–4.05), p = 0.011. Conclusions. High pretreatment plasma TKa levels were significantly associated with worse baseline characteristics and poor response and survival in ICI-treated melanoma patients. TKa is hence a novel and interesting plasma biomarker in melanoma and should be further studied to define its role as a prognostic and predictive marker in this disease. MDPI 2022-01-29 /pmc/articles/PMC8833501/ /pubmed/35158970 http://dx.doi.org/10.3390/cancers14030702 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Costa Svedman, Fernanda Jalsenius, Marie Höiom, Veronica Grozman, Vitali Bergqvist, Mattias Söderdahl, Fabian Eriksson, Hanna Rotstein, Samuel Ny, Lars Ascierto, Paolo A. Brage, Suzanne Egyhazi Helgadottir, Hildur Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title | Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title_full | Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title_fullStr | Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title_full_unstemmed | Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title_short | Plasma Thymidine Kinase Activity as a Novel Biomarker in Metastatic Melanoma Patients Treated with Immune Checkpoint Inhibitors |
title_sort | plasma thymidine kinase activity as a novel biomarker in metastatic melanoma patients treated with immune checkpoint inhibitors |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8833501/ https://www.ncbi.nlm.nih.gov/pubmed/35158970 http://dx.doi.org/10.3390/cancers14030702 |
work_keys_str_mv | AT costasvedmanfernanda plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT jalseniusmarie plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT hoiomveronica plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT grozmanvitali plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT bergqvistmattias plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT soderdahlfabian plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT erikssonhanna plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT rotsteinsamuel plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT nylars plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT asciertopaoloa plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT bragesuzanneegyhazi plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors AT helgadottirhildur plasmathymidinekinaseactivityasanovelbiomarkerinmetastaticmelanomapatientstreatedwithimmunecheckpointinhibitors |