Cargando…

Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A

Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kap...

Descripción completa

Detalles Bibliográficos
Autores principales: Kamihira, Rie, Nakao, Yoichi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8838629/
https://www.ncbi.nlm.nih.gov/pubmed/35164336
http://dx.doi.org/10.3390/molecules27031072
_version_ 1784650173688840192
author Kamihira, Rie
Nakao, Yoichi
author_facet Kamihira, Rie
Nakao, Yoichi
author_sort Kamihira, Rie
collection PubMed
description Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (1) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe.
format Online
Article
Text
id pubmed-8838629
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-88386292022-02-13 Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A Kamihira, Rie Nakao, Yoichi Molecules Article Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (1) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe. MDPI 2022-02-05 /pmc/articles/PMC8838629/ /pubmed/35164336 http://dx.doi.org/10.3390/molecules27031072 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Kamihira, Rie
Nakao, Yoichi
Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_full Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_fullStr Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_full_unstemmed Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_short Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_sort preparation and application of a chemical probe for identifying the targets of the marine cyclic peptide kapakahine a
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8838629/
https://www.ncbi.nlm.nih.gov/pubmed/35164336
http://dx.doi.org/10.3390/molecules27031072
work_keys_str_mv AT kamihirarie preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea
AT nakaoyoichi preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea