Cargando…
Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kap...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8838629/ https://www.ncbi.nlm.nih.gov/pubmed/35164336 http://dx.doi.org/10.3390/molecules27031072 |
_version_ | 1784650173688840192 |
---|---|
author | Kamihira, Rie Nakao, Yoichi |
author_facet | Kamihira, Rie Nakao, Yoichi |
author_sort | Kamihira, Rie |
collection | PubMed |
description | Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (1) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe. |
format | Online Article Text |
id | pubmed-8838629 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-88386292022-02-13 Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A Kamihira, Rie Nakao, Yoichi Molecules Article Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (1) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe. MDPI 2022-02-05 /pmc/articles/PMC8838629/ /pubmed/35164336 http://dx.doi.org/10.3390/molecules27031072 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Kamihira, Rie Nakao, Yoichi Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title_full | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title_fullStr | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title_full_unstemmed | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title_short | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
title_sort | preparation and application of a chemical probe for identifying the targets of the marine cyclic peptide kapakahine a |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8838629/ https://www.ncbi.nlm.nih.gov/pubmed/35164336 http://dx.doi.org/10.3390/molecules27031072 |
work_keys_str_mv | AT kamihirarie preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea AT nakaoyoichi preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea |