Cargando…

Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors

BACKGROUND: Transmissible venereal tumors (TVT) are a wide range of canine tumors for which there are no effective markers to monitor the therapeutic response in real-time. Circulating biomarkers can be valuable in early cancer diagnosis and prognosis. Accordingly, this study aimed to investigate th...

Descripción completa

Detalles Bibliográficos
Autores principales: Mohamadzaheri, Mona, Cheraghi, Hadi, Shirani, Darioush, Hatamkhani, Ali
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8862336/
https://www.ncbi.nlm.nih.gov/pubmed/35189882
http://dx.doi.org/10.1186/s12917-022-03173-z
_version_ 1784655036139175936
author Mohamadzaheri, Mona
Cheraghi, Hadi
Shirani, Darioush
Hatamkhani, Ali
author_facet Mohamadzaheri, Mona
Cheraghi, Hadi
Shirani, Darioush
Hatamkhani, Ali
author_sort Mohamadzaheri, Mona
collection PubMed
description BACKGROUND: Transmissible venereal tumors (TVT) are a wide range of canine tumors for which there are no effective markers to monitor the therapeutic response in real-time. Circulating biomarkers can be valuable in early cancer diagnosis and prognosis. Accordingly, this study aimed to investigate the significance of the cell-free DNA (cfDNA) and cfDNA integrity index to monitor the response of TVTs to vincristine and compare them with lysyl oxidase activity. Plasma and sera were collected from fifteen male dogs within four weeks before drug administration. The analytical method was mainly based on the quantitative polymerase chain reaction (qPCR) technique for short and long cfDNAs and lysyl oxidase activity was measured in serum. RESULTS: The results of the cfDNA integrity index showed a significant (p < 0.05) difference in the baseline concentration compared to the second and third weeks (with cut-off values of 1.118 and 93.33% specificity). The cfDNA integrity index increased over time due to the reduction of short cfDNAs in the first week after treatment. Lysyl oxidase activity increased during the fourth week (p < 0.001), but there were no significant differences in the other weeks compared to the baseline. The ROC analysis of lysyl oxidase revealed high sensitivity (100%) and specificity (90%) on the second and third weeks compared to the baseline. Multivariate analysis between cfDNA integrity index and lysyl oxidase showed significant correlation (p < 0.05) only in baseline results. CONCLUSIONS: Overall, short cfDNA, the cfDNA integrity index, and lysyl oxidase activity can be proposed as diagnostic biomarkers and putative prognostic candidates in TVT patients. These biomarkers can be combined with cytology to quickly diagnose TVT. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12917-022-03173-z.
format Online
Article
Text
id pubmed-8862336
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-88623362022-02-23 Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors Mohamadzaheri, Mona Cheraghi, Hadi Shirani, Darioush Hatamkhani, Ali BMC Vet Res Research BACKGROUND: Transmissible venereal tumors (TVT) are a wide range of canine tumors for which there are no effective markers to monitor the therapeutic response in real-time. Circulating biomarkers can be valuable in early cancer diagnosis and prognosis. Accordingly, this study aimed to investigate the significance of the cell-free DNA (cfDNA) and cfDNA integrity index to monitor the response of TVTs to vincristine and compare them with lysyl oxidase activity. Plasma and sera were collected from fifteen male dogs within four weeks before drug administration. The analytical method was mainly based on the quantitative polymerase chain reaction (qPCR) technique for short and long cfDNAs and lysyl oxidase activity was measured in serum. RESULTS: The results of the cfDNA integrity index showed a significant (p < 0.05) difference in the baseline concentration compared to the second and third weeks (with cut-off values of 1.118 and 93.33% specificity). The cfDNA integrity index increased over time due to the reduction of short cfDNAs in the first week after treatment. Lysyl oxidase activity increased during the fourth week (p < 0.001), but there were no significant differences in the other weeks compared to the baseline. The ROC analysis of lysyl oxidase revealed high sensitivity (100%) and specificity (90%) on the second and third weeks compared to the baseline. Multivariate analysis between cfDNA integrity index and lysyl oxidase showed significant correlation (p < 0.05) only in baseline results. CONCLUSIONS: Overall, short cfDNA, the cfDNA integrity index, and lysyl oxidase activity can be proposed as diagnostic biomarkers and putative prognostic candidates in TVT patients. These biomarkers can be combined with cytology to quickly diagnose TVT. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12917-022-03173-z. BioMed Central 2022-02-21 /pmc/articles/PMC8862336/ /pubmed/35189882 http://dx.doi.org/10.1186/s12917-022-03173-z Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Mohamadzaheri, Mona
Cheraghi, Hadi
Shirani, Darioush
Hatamkhani, Ali
Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title_full Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title_fullStr Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title_full_unstemmed Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title_short Relationship between plasma cell-free DNA changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
title_sort relationship between plasma cell-free dna changes and lysyl oxidase during the treatment and prognosis of canine transmissible venereal tumors
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8862336/
https://www.ncbi.nlm.nih.gov/pubmed/35189882
http://dx.doi.org/10.1186/s12917-022-03173-z
work_keys_str_mv AT mohamadzaherimona relationshipbetweenplasmacellfreednachangesandlysyloxidaseduringthetreatmentandprognosisofcaninetransmissiblevenerealtumors
AT cheraghihadi relationshipbetweenplasmacellfreednachangesandlysyloxidaseduringthetreatmentandprognosisofcaninetransmissiblevenerealtumors
AT shiranidarioush relationshipbetweenplasmacellfreednachangesandlysyloxidaseduringthetreatmentandprognosisofcaninetransmissiblevenerealtumors
AT hatamkhaniali relationshipbetweenplasmacellfreednachangesandlysyloxidaseduringthetreatmentandprognosisofcaninetransmissiblevenerealtumors