Cargando…
Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals
BACKGROUND: Canopy architecture is critical in determining the light environment and subsequently the photosynthetic productivity of fruit crops. Numerous CCT domain-containing genes are crucial for plant adaptive responses to diverse environmental cues. Two CCT genes, the orthologues of AtPRR5 in p...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8864873/ https://www.ncbi.nlm.nih.gov/pubmed/35196984 http://dx.doi.org/10.1186/s12870-022-03476-1 |
_version_ | 1784655540743307264 |
---|---|
author | Liu, Zheng Liu, Jia-Li An, Lin Wu, Tao Yang, Li Cheng, Yin-Sheng Nie, Xian-Shuang Qin, Zhong-Qi |
author_facet | Liu, Zheng Liu, Jia-Li An, Lin Wu, Tao Yang, Li Cheng, Yin-Sheng Nie, Xian-Shuang Qin, Zhong-Qi |
author_sort | Liu, Zheng |
collection | PubMed |
description | BACKGROUND: Canopy architecture is critical in determining the light environment and subsequently the photosynthetic productivity of fruit crops. Numerous CCT domain-containing genes are crucial for plant adaptive responses to diverse environmental cues. Two CCT genes, the orthologues of AtPRR5 in pear, have been reported to be strongly correlated with photosynthetic performance under distinct canopy microclimates. However, knowledge concerning the specific expression patterns and roles of pear CCT family genes (PbCCTs) remains very limited. The key roles played by PbCCTs in the light response led us to examine this large gene family in more detail. RESULTS: Genome-wide sequence analysis identified 42 putative PbCCTs in the genome of pear (Pyrus bretschneideri Rehd.). Phylogenetic analysis indicated that these genes were divided into five subfamilies, namely, COL (14 members), PRR (8 members), ZIM (6 members), TCR1 (6 members) and ASML2 (8 members). Analysis of exon–intron structures and conserved domains provided support for the classification. Genome duplication analysis indicated that whole-genome duplication/segmental duplication events played a crucial role in the expansion of the CCT family in pear and that the CCT family evolved under the effect of purifying selection. Expression profiles exhibited diverse expression patterns of PbCCTs in various tissues and in response to varying light signals. Additionally, transient overexpression of PbPRR2 in tobacco leaves resulted in inhibition of photosynthetic performance, suggesting its possible involvement in the repression of photosynthesis. CONCLUSIONS: This study provides a comprehensive analysis of the CCT gene family in pear and will facilitate further functional investigations of PbCCTs to uncover their biological roles in the light response. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12870-022-03476-1. |
format | Online Article Text |
id | pubmed-8864873 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-88648732022-02-28 Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals Liu, Zheng Liu, Jia-Li An, Lin Wu, Tao Yang, Li Cheng, Yin-Sheng Nie, Xian-Shuang Qin, Zhong-Qi BMC Plant Biol Research BACKGROUND: Canopy architecture is critical in determining the light environment and subsequently the photosynthetic productivity of fruit crops. Numerous CCT domain-containing genes are crucial for plant adaptive responses to diverse environmental cues. Two CCT genes, the orthologues of AtPRR5 in pear, have been reported to be strongly correlated with photosynthetic performance under distinct canopy microclimates. However, knowledge concerning the specific expression patterns and roles of pear CCT family genes (PbCCTs) remains very limited. The key roles played by PbCCTs in the light response led us to examine this large gene family in more detail. RESULTS: Genome-wide sequence analysis identified 42 putative PbCCTs in the genome of pear (Pyrus bretschneideri Rehd.). Phylogenetic analysis indicated that these genes were divided into five subfamilies, namely, COL (14 members), PRR (8 members), ZIM (6 members), TCR1 (6 members) and ASML2 (8 members). Analysis of exon–intron structures and conserved domains provided support for the classification. Genome duplication analysis indicated that whole-genome duplication/segmental duplication events played a crucial role in the expansion of the CCT family in pear and that the CCT family evolved under the effect of purifying selection. Expression profiles exhibited diverse expression patterns of PbCCTs in various tissues and in response to varying light signals. Additionally, transient overexpression of PbPRR2 in tobacco leaves resulted in inhibition of photosynthetic performance, suggesting its possible involvement in the repression of photosynthesis. CONCLUSIONS: This study provides a comprehensive analysis of the CCT gene family in pear and will facilitate further functional investigations of PbCCTs to uncover their biological roles in the light response. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12870-022-03476-1. BioMed Central 2022-02-23 /pmc/articles/PMC8864873/ /pubmed/35196984 http://dx.doi.org/10.1186/s12870-022-03476-1 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Liu, Zheng Liu, Jia-Li An, Lin Wu, Tao Yang, Li Cheng, Yin-Sheng Nie, Xian-Shuang Qin, Zhong-Qi Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title | Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title_full | Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title_fullStr | Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title_full_unstemmed | Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title_short | Genome-wide analysis of the CCT gene family in Chinese white pear (Pyrus bretschneideri Rehd.) and characterization of PbPRR2 in response to varying light signals |
title_sort | genome-wide analysis of the cct gene family in chinese white pear (pyrus bretschneideri rehd.) and characterization of pbprr2 in response to varying light signals |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8864873/ https://www.ncbi.nlm.nih.gov/pubmed/35196984 http://dx.doi.org/10.1186/s12870-022-03476-1 |
work_keys_str_mv | AT liuzheng genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT liujiali genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT anlin genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT wutao genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT yangli genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT chengyinsheng genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT niexianshuang genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals AT qinzhongqi genomewideanalysisofthecctgenefamilyinchinesewhitepearpyrusbretschneiderirehdandcharacterizationofpbprr2inresponsetovaryinglightsignals |