Cargando…

Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review

Antimicrobial resistance to treatments for Clostridioides difficile infection (CDI) poses a significant threat to global health. C. difficile is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, clinical labs do not conduct C. difficil...

Descripción completa

Detalles Bibliográficos
Autores principales: Eubank, Taryn A., Gonzales-Luna, Anne J., Hurdle, Julian G., Garey, Kevin W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8868222/
https://www.ncbi.nlm.nih.gov/pubmed/35203860
http://dx.doi.org/10.3390/antibiotics11020258
_version_ 1784656214934683648
author Eubank, Taryn A.
Gonzales-Luna, Anne J.
Hurdle, Julian G.
Garey, Kevin W.
author_facet Eubank, Taryn A.
Gonzales-Luna, Anne J.
Hurdle, Julian G.
Garey, Kevin W.
author_sort Eubank, Taryn A.
collection PubMed
description Antimicrobial resistance to treatments for Clostridioides difficile infection (CDI) poses a significant threat to global health. C. difficile is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, clinical labs do not conduct C. difficile susceptibility testing, presenting a challenge to detecting the emergence and impact of resistance. In this systematic review, we describe gene determinants and associated clinical and laboratory mechanisms of vancomycin resistance in C. difficile, including drug-binding site alterations, efflux pumps, RNA polymerase mutations, and biofilm formation. Additional research is needed to further characterize these mechanisms and understand their clinical impact.
format Online
Article
Text
id pubmed-8868222
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-88682222022-02-25 Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review Eubank, Taryn A. Gonzales-Luna, Anne J. Hurdle, Julian G. Garey, Kevin W. Antibiotics (Basel) Review Antimicrobial resistance to treatments for Clostridioides difficile infection (CDI) poses a significant threat to global health. C. difficile is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, clinical labs do not conduct C. difficile susceptibility testing, presenting a challenge to detecting the emergence and impact of resistance. In this systematic review, we describe gene determinants and associated clinical and laboratory mechanisms of vancomycin resistance in C. difficile, including drug-binding site alterations, efflux pumps, RNA polymerase mutations, and biofilm formation. Additional research is needed to further characterize these mechanisms and understand their clinical impact. MDPI 2022-02-16 /pmc/articles/PMC8868222/ /pubmed/35203860 http://dx.doi.org/10.3390/antibiotics11020258 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Eubank, Taryn A.
Gonzales-Luna, Anne J.
Hurdle, Julian G.
Garey, Kevin W.
Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title_full Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title_fullStr Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title_full_unstemmed Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title_short Genetic Mechanisms of Vancomycin Resistance in Clostridioides difficile: A Systematic Review
title_sort genetic mechanisms of vancomycin resistance in clostridioides difficile: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8868222/
https://www.ncbi.nlm.nih.gov/pubmed/35203860
http://dx.doi.org/10.3390/antibiotics11020258
work_keys_str_mv AT eubanktaryna geneticmechanismsofvancomycinresistanceinclostridioidesdifficileasystematicreview
AT gonzaleslunaannej geneticmechanismsofvancomycinresistanceinclostridioidesdifficileasystematicreview
AT hurdlejuliang geneticmechanismsofvancomycinresistanceinclostridioidesdifficileasystematicreview
AT gareykevinw geneticmechanismsofvancomycinresistanceinclostridioidesdifficileasystematicreview