Cargando…

Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis

The hypothalamus–pituitary–testis axis controls the production of spermatozoa, and the kisspeptin system, comprising Kiss1 and Kiss1 receptor (Kiss1R), is the main central gatekeeper. The activity of the kisspeptin system also occurs in testis and spermatozoa, but currently the need of peripheral ki...

Descripción completa

Detalles Bibliográficos
Autores principales: Mele, Elena, D’Auria, Raffaella, Scafuro, Marika, Marino, Marianna, Fasano, Silvia, Viggiano, Andrea, Pierantoni, Riccardo, Santoro, Antonietta, Meccariello, Rosaria
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8871750/
https://www.ncbi.nlm.nih.gov/pubmed/35205340
http://dx.doi.org/10.3390/genes13020295
_version_ 1784657070430093312
author Mele, Elena
D’Auria, Raffaella
Scafuro, Marika
Marino, Marianna
Fasano, Silvia
Viggiano, Andrea
Pierantoni, Riccardo
Santoro, Antonietta
Meccariello, Rosaria
author_facet Mele, Elena
D’Auria, Raffaella
Scafuro, Marika
Marino, Marianna
Fasano, Silvia
Viggiano, Andrea
Pierantoni, Riccardo
Santoro, Antonietta
Meccariello, Rosaria
author_sort Mele, Elena
collection PubMed
description The hypothalamus–pituitary–testis axis controls the production of spermatozoa, and the kisspeptin system, comprising Kiss1 and Kiss1 receptor (Kiss1R), is the main central gatekeeper. The activity of the kisspeptin system also occurs in testis and spermatozoa, but currently the need of peripheral kisspeptin to produce gametes is not fully understood. Hence, we characterized kisspeptin system in rat spermatozoa and epididymis caput and cauda and analyzed the possible presence of Kiss1 in the epididymal fluid. The presence of Kiss1 and Kiss1R in spermatozoa collected from epididymis caput and cauda was evaluated by Western blot; significant high Kiss1 levels in the caput (p < 0.001 vs. cauda) and constant levels of Kiss1R proteins were observed. Immunofluorescence analysis revealed that the localization of Kiss1R in sperm head shifts from the posterior region in the epididymis caput to perforatorium in the epididymis cauda. In spermatozoa-free epididymis, Western blot revealed higher expression of Kiss1 and Kiss1R in caput (p < 0.05 vs. cauda). Moreover, immunohistochemistry revealed that Kiss1 and Kiss1R proteins were mainly localized in the secretory epithelial cell types and in contractile myoid cells, respectively. Finally, both dot blot and Elisa revealed the presence of Kiss1 in the epididymal fluid collected from epididymis cauda and caput, indicating that rat epididymis and spermatozoa possess a complete kisspeptin system. In conclusion, we reported for the first time in rodents Kiss1R trafficking in spermatozoa during the epididymis transit and Kiss1 measure in the epididymal fluid, thus suggesting a possible role for the system in spermatozoa maturation and storage within the epididymis.
format Online
Article
Text
id pubmed-8871750
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-88717502022-02-25 Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis Mele, Elena D’Auria, Raffaella Scafuro, Marika Marino, Marianna Fasano, Silvia Viggiano, Andrea Pierantoni, Riccardo Santoro, Antonietta Meccariello, Rosaria Genes (Basel) Article The hypothalamus–pituitary–testis axis controls the production of spermatozoa, and the kisspeptin system, comprising Kiss1 and Kiss1 receptor (Kiss1R), is the main central gatekeeper. The activity of the kisspeptin system also occurs in testis and spermatozoa, but currently the need of peripheral kisspeptin to produce gametes is not fully understood. Hence, we characterized kisspeptin system in rat spermatozoa and epididymis caput and cauda and analyzed the possible presence of Kiss1 in the epididymal fluid. The presence of Kiss1 and Kiss1R in spermatozoa collected from epididymis caput and cauda was evaluated by Western blot; significant high Kiss1 levels in the caput (p < 0.001 vs. cauda) and constant levels of Kiss1R proteins were observed. Immunofluorescence analysis revealed that the localization of Kiss1R in sperm head shifts from the posterior region in the epididymis caput to perforatorium in the epididymis cauda. In spermatozoa-free epididymis, Western blot revealed higher expression of Kiss1 and Kiss1R in caput (p < 0.05 vs. cauda). Moreover, immunohistochemistry revealed that Kiss1 and Kiss1R proteins were mainly localized in the secretory epithelial cell types and in contractile myoid cells, respectively. Finally, both dot blot and Elisa revealed the presence of Kiss1 in the epididymal fluid collected from epididymis cauda and caput, indicating that rat epididymis and spermatozoa possess a complete kisspeptin system. In conclusion, we reported for the first time in rodents Kiss1R trafficking in spermatozoa during the epididymis transit and Kiss1 measure in the epididymal fluid, thus suggesting a possible role for the system in spermatozoa maturation and storage within the epididymis. MDPI 2022-02-02 /pmc/articles/PMC8871750/ /pubmed/35205340 http://dx.doi.org/10.3390/genes13020295 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Mele, Elena
D’Auria, Raffaella
Scafuro, Marika
Marino, Marianna
Fasano, Silvia
Viggiano, Andrea
Pierantoni, Riccardo
Santoro, Antonietta
Meccariello, Rosaria
Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title_full Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title_fullStr Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title_full_unstemmed Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title_short Differential Expression of Kisspeptin System and Kisspeptin Receptor Trafficking during Spermatozoa Transit in the Epididymis
title_sort differential expression of kisspeptin system and kisspeptin receptor trafficking during spermatozoa transit in the epididymis
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8871750/
https://www.ncbi.nlm.nih.gov/pubmed/35205340
http://dx.doi.org/10.3390/genes13020295
work_keys_str_mv AT meleelena differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT dauriaraffaella differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT scafuromarika differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT marinomarianna differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT fasanosilvia differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT viggianoandrea differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT pierantoniriccardo differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT santoroantonietta differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis
AT meccariellorosaria differentialexpressionofkisspeptinsystemandkisspeptinreceptortraffickingduringspermatozoatransitintheepididymis