Cargando…
Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.)
Proline-rich extensin-like receptor kinases (PERKs) are a class of receptor kinases implicated in multiple cellular processes in plants. However, there is a lack of information on the PERK gene family in wheat. Therefore, we identified 37 PERK genes in wheat to understand their role in various devel...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880425/ https://www.ncbi.nlm.nih.gov/pubmed/35214830 http://dx.doi.org/10.3390/plants11040496 |
_version_ | 1784659197456023552 |
---|---|
author | Kesawat, Mahipal Singh Kherawat, Bhagwat Singh Singh, Anupama Dey, Prajjal Routray, Snehasish Mohapatra, Chinmayee Saha, Debanjana Ram, Chet Siddique, Kadambot H. M. Kumar, Ajay Gupta, Ravi Chung, Sang-Min Kumar, Manu |
author_facet | Kesawat, Mahipal Singh Kherawat, Bhagwat Singh Singh, Anupama Dey, Prajjal Routray, Snehasish Mohapatra, Chinmayee Saha, Debanjana Ram, Chet Siddique, Kadambot H. M. Kumar, Ajay Gupta, Ravi Chung, Sang-Min Kumar, Manu |
author_sort | Kesawat, Mahipal Singh |
collection | PubMed |
description | Proline-rich extensin-like receptor kinases (PERKs) are a class of receptor kinases implicated in multiple cellular processes in plants. However, there is a lack of information on the PERK gene family in wheat. Therefore, we identified 37 PERK genes in wheat to understand their role in various developmental processes and stress conditions. Phylogenetic analysis of PERK genes from Arabidopsis thaliana, Oryza sativa, Glycine max, and T. aestivum grouped them into eight well-defined classes. Furthermore, synteny analysis revealed 275 orthologous gene pairs in B. distachyon, Ae. tauschii, T. dicoccoides, O. sativa and A. thaliana. Ka/Ks values showed that most TaPERK genes, except TaPERK1, TaPERK2, TaPERK17, and TaPERK26, underwent strong purifying selection during evolutionary processes. Several cis-acting regulatory elements, essential for plant growth and development and the response to light, phytohormones, and diverse biotic and abiotic stresses, were predicted in the promoter regions of TaPERK genes. In addition, the expression profile of the TaPERK gene family revealed differential expression of TaPERK genes in various tissues and developmental stages. Furthermore, TaPERK gene expression was induced by various biotic and abiotic stresses. The RT-qPCR analysis also revealed similar results with slight variation. Therefore, this study’s outcome provides valuable information for elucidating the precise functions of TaPERK in developmental processes and diverse stress conditions in wheat. |
format | Online Article Text |
id | pubmed-8880425 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-88804252022-02-26 Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) Kesawat, Mahipal Singh Kherawat, Bhagwat Singh Singh, Anupama Dey, Prajjal Routray, Snehasish Mohapatra, Chinmayee Saha, Debanjana Ram, Chet Siddique, Kadambot H. M. Kumar, Ajay Gupta, Ravi Chung, Sang-Min Kumar, Manu Plants (Basel) Article Proline-rich extensin-like receptor kinases (PERKs) are a class of receptor kinases implicated in multiple cellular processes in plants. However, there is a lack of information on the PERK gene family in wheat. Therefore, we identified 37 PERK genes in wheat to understand their role in various developmental processes and stress conditions. Phylogenetic analysis of PERK genes from Arabidopsis thaliana, Oryza sativa, Glycine max, and T. aestivum grouped them into eight well-defined classes. Furthermore, synteny analysis revealed 275 orthologous gene pairs in B. distachyon, Ae. tauschii, T. dicoccoides, O. sativa and A. thaliana. Ka/Ks values showed that most TaPERK genes, except TaPERK1, TaPERK2, TaPERK17, and TaPERK26, underwent strong purifying selection during evolutionary processes. Several cis-acting regulatory elements, essential for plant growth and development and the response to light, phytohormones, and diverse biotic and abiotic stresses, were predicted in the promoter regions of TaPERK genes. In addition, the expression profile of the TaPERK gene family revealed differential expression of TaPERK genes in various tissues and developmental stages. Furthermore, TaPERK gene expression was induced by various biotic and abiotic stresses. The RT-qPCR analysis also revealed similar results with slight variation. Therefore, this study’s outcome provides valuable information for elucidating the precise functions of TaPERK in developmental processes and diverse stress conditions in wheat. MDPI 2022-02-11 /pmc/articles/PMC8880425/ /pubmed/35214830 http://dx.doi.org/10.3390/plants11040496 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Kesawat, Mahipal Singh Kherawat, Bhagwat Singh Singh, Anupama Dey, Prajjal Routray, Snehasish Mohapatra, Chinmayee Saha, Debanjana Ram, Chet Siddique, Kadambot H. M. Kumar, Ajay Gupta, Ravi Chung, Sang-Min Kumar, Manu Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title | Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title_full | Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title_fullStr | Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title_full_unstemmed | Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title_short | Genome-Wide Analysis and Characterization of the Proline-Rich Extensin-like Receptor Kinases (PERKs) Gene Family Reveals Their Role in Different Developmental Stages and Stress Conditions in Wheat (Triticum aestivum L.) |
title_sort | genome-wide analysis and characterization of the proline-rich extensin-like receptor kinases (perks) gene family reveals their role in different developmental stages and stress conditions in wheat (triticum aestivum l.) |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880425/ https://www.ncbi.nlm.nih.gov/pubmed/35214830 http://dx.doi.org/10.3390/plants11040496 |
work_keys_str_mv | AT kesawatmahipalsingh genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT kherawatbhagwatsingh genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT singhanupama genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT deyprajjal genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT routraysnehasish genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT mohapatrachinmayee genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT sahadebanjana genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT ramchet genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT siddiquekadambothm genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT kumarajay genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT guptaravi genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT chungsangmin genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml AT kumarmanu genomewideanalysisandcharacterizationoftheprolinerichextensinlikereceptorkinasesperksgenefamilyrevealstheirroleindifferentdevelopmentalstagesandstressconditionsinwheattriticumaestivuml |