Cargando…

Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses

Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransfer...

Descripción completa

Detalles Bibliográficos
Autores principales: Ramdhan, Peter, Li, Chenglong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880702/
https://www.ncbi.nlm.nih.gov/pubmed/35215972
http://dx.doi.org/10.3390/v14020379
_version_ 1784659284933476352
author Ramdhan, Peter
Li, Chenglong
author_facet Ramdhan, Peter
Li, Chenglong
author_sort Ramdhan, Peter
collection PubMed
description Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransferases that exist within single-stranded RNA (ssRNA) viruses along with their respective inhibitors. Additionally, the importance of motifs such as the KDKE tetrad and glycine-rich motif in the catalytic activity of methyltransferases is discussed.
format Online
Article
Text
id pubmed-8880702
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-88807022022-02-26 Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses Ramdhan, Peter Li, Chenglong Viruses Review Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransferases that exist within single-stranded RNA (ssRNA) viruses along with their respective inhibitors. Additionally, the importance of motifs such as the KDKE tetrad and glycine-rich motif in the catalytic activity of methyltransferases is discussed. MDPI 2022-02-12 /pmc/articles/PMC8880702/ /pubmed/35215972 http://dx.doi.org/10.3390/v14020379 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Ramdhan, Peter
Li, Chenglong
Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title_full Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title_fullStr Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title_full_unstemmed Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title_short Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
title_sort targeting viral methyltransferases: an approach to antiviral treatment for ssrna viruses
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880702/
https://www.ncbi.nlm.nih.gov/pubmed/35215972
http://dx.doi.org/10.3390/v14020379
work_keys_str_mv AT ramdhanpeter targetingviralmethyltransferasesanapproachtoantiviraltreatmentforssrnaviruses
AT lichenglong targetingviralmethyltransferasesanapproachtoantiviraltreatmentforssrnaviruses