Cargando…
Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses
Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransfer...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880702/ https://www.ncbi.nlm.nih.gov/pubmed/35215972 http://dx.doi.org/10.3390/v14020379 |
_version_ | 1784659284933476352 |
---|---|
author | Ramdhan, Peter Li, Chenglong |
author_facet | Ramdhan, Peter Li, Chenglong |
author_sort | Ramdhan, Peter |
collection | PubMed |
description | Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransferases that exist within single-stranded RNA (ssRNA) viruses along with their respective inhibitors. Additionally, the importance of motifs such as the KDKE tetrad and glycine-rich motif in the catalytic activity of methyltransferases is discussed. |
format | Online Article Text |
id | pubmed-8880702 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-88807022022-02-26 Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses Ramdhan, Peter Li, Chenglong Viruses Review Methyltransferase enzymes have been associated with different processes within cells and viruses. Specifically, within viruses, methyltransferases are used to form the 5′cap-0 structure for optimal evasion of the host innate immune system. In this paper, we seek to discuss the various methyltransferases that exist within single-stranded RNA (ssRNA) viruses along with their respective inhibitors. Additionally, the importance of motifs such as the KDKE tetrad and glycine-rich motif in the catalytic activity of methyltransferases is discussed. MDPI 2022-02-12 /pmc/articles/PMC8880702/ /pubmed/35215972 http://dx.doi.org/10.3390/v14020379 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Ramdhan, Peter Li, Chenglong Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title | Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title_full | Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title_fullStr | Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title_full_unstemmed | Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title_short | Targeting Viral Methyltransferases: An Approach to Antiviral Treatment for ssRNA Viruses |
title_sort | targeting viral methyltransferases: an approach to antiviral treatment for ssrna viruses |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880702/ https://www.ncbi.nlm.nih.gov/pubmed/35215972 http://dx.doi.org/10.3390/v14020379 |
work_keys_str_mv | AT ramdhanpeter targetingviralmethyltransferasesanapproachtoantiviraltreatmentforssrnaviruses AT lichenglong targetingviralmethyltransferasesanapproachtoantiviraltreatmentforssrnaviruses |