Cargando…

The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan

The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA gene...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Song, Liu, Jinlong, Chirikova, Marina A., Zhang, Bin, Guo, Xianguang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8896179/
https://www.ncbi.nlm.nih.gov/pubmed/35252580
http://dx.doi.org/10.1080/23802359.2022.2047119
_version_ 1784663100091269120
author Wang, Song
Liu, Jinlong
Chirikova, Marina A.
Zhang, Bin
Guo, Xianguang
author_facet Wang, Song
Liu, Jinlong
Chirikova, Marina A.
Zhang, Bin
Guo, Xianguang
author_sort Wang, Song
collection PubMed
description The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners.
format Online
Article
Text
id pubmed-8896179
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-88961792022-03-05 The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan Wang, Song Liu, Jinlong Chirikova, Marina A. Zhang, Bin Guo, Xianguang Mitochondrial DNA B Resour Mitogenome Announcement The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners. Taylor & Francis 2022-03-02 /pmc/articles/PMC8896179/ /pubmed/35252580 http://dx.doi.org/10.1080/23802359.2022.2047119 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Wang, Song
Liu, Jinlong
Chirikova, Marina A.
Zhang, Bin
Guo, Xianguang
The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title_full The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title_fullStr The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title_full_unstemmed The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title_short The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
title_sort complete mitochondrial genome of eremias yarkandensis (reptilia, squamata, lacertidae) from kyrgyzstan
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8896179/
https://www.ncbi.nlm.nih.gov/pubmed/35252580
http://dx.doi.org/10.1080/23802359.2022.2047119
work_keys_str_mv AT wangsong thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT liujinlong thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT chirikovamarinaa thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT zhangbin thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT guoxianguang thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT wangsong completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT liujinlong completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT chirikovamarinaa completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT zhangbin completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan
AT guoxianguang completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan