Cargando…
The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA gene...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8896179/ https://www.ncbi.nlm.nih.gov/pubmed/35252580 http://dx.doi.org/10.1080/23802359.2022.2047119 |
_version_ | 1784663100091269120 |
---|---|
author | Wang, Song Liu, Jinlong Chirikova, Marina A. Zhang, Bin Guo, Xianguang |
author_facet | Wang, Song Liu, Jinlong Chirikova, Marina A. Zhang, Bin Guo, Xianguang |
author_sort | Wang, Song |
collection | PubMed |
description | The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners. |
format | Online Article Text |
id | pubmed-8896179 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-88961792022-03-05 The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan Wang, Song Liu, Jinlong Chirikova, Marina A. Zhang, Bin Guo, Xianguang Mitochondrial DNA B Resour Mitogenome Announcement The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners. Taylor & Francis 2022-03-02 /pmc/articles/PMC8896179/ /pubmed/35252580 http://dx.doi.org/10.1080/23802359.2022.2047119 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement Wang, Song Liu, Jinlong Chirikova, Marina A. Zhang, Bin Guo, Xianguang The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title_full | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title_fullStr | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title_full_unstemmed | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title_short | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
title_sort | complete mitochondrial genome of eremias yarkandensis (reptilia, squamata, lacertidae) from kyrgyzstan |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8896179/ https://www.ncbi.nlm.nih.gov/pubmed/35252580 http://dx.doi.org/10.1080/23802359.2022.2047119 |
work_keys_str_mv | AT wangsong thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT liujinlong thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT chirikovamarinaa thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT zhangbin thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT guoxianguang thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT wangsong completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT liujinlong completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT chirikovamarinaa completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT zhangbin completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT guoxianguang completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan |