Cargando…
Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats
OBJECTIVE: This study was conducted to estimate multi-trait genetic parameters for somatic cell score (SCS), milk yield and type traits in Nigerian Dwarf (ND) goats from the United States. METHODS: Data from 1,041 ND goats in the United States with kiddings in 95 herds were used to estimate multi-tr...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Animal Bioscience
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8902223/ https://www.ncbi.nlm.nih.gov/pubmed/34237919 http://dx.doi.org/10.5713/ab.21.0143 |
_version_ | 1784664553001320448 |
---|---|
author | Valencia-Posadas, Mauricio Lechuga-Arana, Alma Arianna Ávila-Ramos, Fidel Shepard, Lisa Montaldo, Hugo H. |
author_facet | Valencia-Posadas, Mauricio Lechuga-Arana, Alma Arianna Ávila-Ramos, Fidel Shepard, Lisa Montaldo, Hugo H. |
author_sort | Valencia-Posadas, Mauricio |
collection | PubMed |
description | OBJECTIVE: This study was conducted to estimate multi-trait genetic parameters for somatic cell score (SCS), milk yield and type traits in Nigerian Dwarf (ND) goats from the United States. METHODS: Data from 1,041 ND goats in the United States with kiddings in 95 herds were used to estimate multi-trait genetic parameters for SCS, milk (MILK), fat (FAT), and protein (PROT) yields, and 14 type traits. An 18-trait mixed linear animal model for lactation mean SCS (Log(2)), MILK, FAT, PROT, and 14 type traits was applied. A factor analytic approach (FA1) in ASReml software was used to obtain convergence. RESULTS: Averages for SCS were low (2.85±1.29 Log(2)), and were 314±110.6, 20.9±7.4, and 14±4.9 kg, respectively, for MILK, FAT, and PROT. Heritabilities for SCS, MILK, FAT, and PROT were 0.32, 0.16, 0.16, and 0.10, respectively. The highest heritabilities for type traits were for stature (0.72), teat diameter (0.49), and rump width (0.48), and the lowest estimates were for dairyness (0.003) and medial suspensory ligament (0.03). Genetic correlations of SCS with MILK, FAT, and PROT were positive but low (0.25, 0.18, and 0.23, respectively). Genetic and phenotypic correlations between MILK, FAT, and PROT were high and positive (≥0.66). Absolute values of genetic correlations involving SCS with type traits were generally low or no different from zero. Most of the phenotypic correlations involving SCS with type traits were low. No serious unfavorable genetic correlations between milk yield traits and SCS or between milk yield traits or SCS and type traits were found. CONCLUSION: Genetic variation exists in the ND breed for most studied traits. The development of selection programs based on these estimates may help accelerate favorable multi-trait genetic changes in this breed. |
format | Online Article Text |
id | pubmed-8902223 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Animal Bioscience |
record_format | MEDLINE/PubMed |
spelling | pubmed-89022232022-03-16 Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats Valencia-Posadas, Mauricio Lechuga-Arana, Alma Arianna Ávila-Ramos, Fidel Shepard, Lisa Montaldo, Hugo H. Anim Biosci Article OBJECTIVE: This study was conducted to estimate multi-trait genetic parameters for somatic cell score (SCS), milk yield and type traits in Nigerian Dwarf (ND) goats from the United States. METHODS: Data from 1,041 ND goats in the United States with kiddings in 95 herds were used to estimate multi-trait genetic parameters for SCS, milk (MILK), fat (FAT), and protein (PROT) yields, and 14 type traits. An 18-trait mixed linear animal model for lactation mean SCS (Log(2)), MILK, FAT, PROT, and 14 type traits was applied. A factor analytic approach (FA1) in ASReml software was used to obtain convergence. RESULTS: Averages for SCS were low (2.85±1.29 Log(2)), and were 314±110.6, 20.9±7.4, and 14±4.9 kg, respectively, for MILK, FAT, and PROT. Heritabilities for SCS, MILK, FAT, and PROT were 0.32, 0.16, 0.16, and 0.10, respectively. The highest heritabilities for type traits were for stature (0.72), teat diameter (0.49), and rump width (0.48), and the lowest estimates were for dairyness (0.003) and medial suspensory ligament (0.03). Genetic correlations of SCS with MILK, FAT, and PROT were positive but low (0.25, 0.18, and 0.23, respectively). Genetic and phenotypic correlations between MILK, FAT, and PROT were high and positive (≥0.66). Absolute values of genetic correlations involving SCS with type traits were generally low or no different from zero. Most of the phenotypic correlations involving SCS with type traits were low. No serious unfavorable genetic correlations between milk yield traits and SCS or between milk yield traits or SCS and type traits were found. CONCLUSION: Genetic variation exists in the ND breed for most studied traits. The development of selection programs based on these estimates may help accelerate favorable multi-trait genetic changes in this breed. Animal Bioscience 2022-03 2021-06-23 /pmc/articles/PMC8902223/ /pubmed/34237919 http://dx.doi.org/10.5713/ab.21.0143 Text en Copyright © 2022 by Animal Bioscience https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Article Valencia-Posadas, Mauricio Lechuga-Arana, Alma Arianna Ávila-Ramos, Fidel Shepard, Lisa Montaldo, Hugo H. Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title | Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title_full | Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title_fullStr | Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title_full_unstemmed | Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title_short | Genetic parameters for somatic cell score, milk yield and type traits in Nigerian Dwarf goats |
title_sort | genetic parameters for somatic cell score, milk yield and type traits in nigerian dwarf goats |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8902223/ https://www.ncbi.nlm.nih.gov/pubmed/34237919 http://dx.doi.org/10.5713/ab.21.0143 |
work_keys_str_mv | AT valenciaposadasmauricio geneticparametersforsomaticcellscoremilkyieldandtypetraitsinnigeriandwarfgoats AT lechugaaranaalmaarianna geneticparametersforsomaticcellscoremilkyieldandtypetraitsinnigeriandwarfgoats AT avilaramosfidel geneticparametersforsomaticcellscoremilkyieldandtypetraitsinnigeriandwarfgoats AT shepardlisa geneticparametersforsomaticcellscoremilkyieldandtypetraitsinnigeriandwarfgoats AT montaldohugoh geneticparametersforsomaticcellscoremilkyieldandtypetraitsinnigeriandwarfgoats |