Cargando…
Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden
BACKGROUND: While the utilitarian crops grown in vicarage gardens in pre-industrial Sweden have been fairly well documented, our knowledge of plants cultivated for food among the peasants and crofters is limited. Nevertheless, garden vegetables and herbs played a much more important role in the diet...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8908593/ https://www.ncbi.nlm.nih.gov/pubmed/35272679 http://dx.doi.org/10.1186/s13002-022-00513-z |
_version_ | 1784665909499002880 |
---|---|
author | de Vahl, Erik Svanberg, Ingvar |
author_facet | de Vahl, Erik Svanberg, Ingvar |
author_sort | de Vahl, Erik |
collection | PubMed |
description | BACKGROUND: While the utilitarian crops grown in vicarage gardens in pre-industrial Sweden have been fairly well documented, our knowledge of plants cultivated for food among the peasants and crofters is limited. Nevertheless, garden vegetables and herbs played a much more important role in the diet of the rural population from a nutritional point of view than, say, wild plants, at least in the southern part of the country. This study aims to explore the importance of edible cultivated onions, Allium, and their various cultivars and old landraces that were once—and in some cases still are—grown in home gardens. METHODS: This study is based on documentation collected from national surveys carried out by the Swedish National Programme for Diversity of Cultivated Plants (POM), and from an intense search for references to the cultivation and use of carious onions in the historic garden literature, herbals and ethnographic records found in responses to folklife questionnaires. RESULTS: The rural population in pre-industrial Sweden cultivated various kinds of bulb onions. They are known under various folk names, although their taxonomic affiliation has been unclear. Many folk taxa have been classified and named by their use, while other names refer to the practices associated with the cultivation system. These onions were often described as especially well suited for storage over winter. Onions have had a wide range of uses in Sweden. In some parts of Sweden, onions were eaten during church service in order to keep the churchgoers awake. Several types of onion have commonly been used as condiments in pickled herring dishes, spreads, sauces, foods made of blood and offal, dumplings, meat dishes and soups. Garlic was used for medicinal and magical purposes, as well as for ethnoveterinary medicine. Onion skins have traditionally been used for dyeing eggs at Easter. CONCLUSION: Genetic diversity of vegetables and garden crops represents a critical resource to achieve and maintain global food security. Therefore, ethnobiologists studying agricultural societies should place more focus on old landraces, cultivars and cultivation practices in order to understand the importance of garden crops for a society. They are an important element of sustainability. |
format | Online Article Text |
id | pubmed-8908593 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-89085932022-03-18 Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden de Vahl, Erik Svanberg, Ingvar J Ethnobiol Ethnomed Research BACKGROUND: While the utilitarian crops grown in vicarage gardens in pre-industrial Sweden have been fairly well documented, our knowledge of plants cultivated for food among the peasants and crofters is limited. Nevertheless, garden vegetables and herbs played a much more important role in the diet of the rural population from a nutritional point of view than, say, wild plants, at least in the southern part of the country. This study aims to explore the importance of edible cultivated onions, Allium, and their various cultivars and old landraces that were once—and in some cases still are—grown in home gardens. METHODS: This study is based on documentation collected from national surveys carried out by the Swedish National Programme for Diversity of Cultivated Plants (POM), and from an intense search for references to the cultivation and use of carious onions in the historic garden literature, herbals and ethnographic records found in responses to folklife questionnaires. RESULTS: The rural population in pre-industrial Sweden cultivated various kinds of bulb onions. They are known under various folk names, although their taxonomic affiliation has been unclear. Many folk taxa have been classified and named by their use, while other names refer to the practices associated with the cultivation system. These onions were often described as especially well suited for storage over winter. Onions have had a wide range of uses in Sweden. In some parts of Sweden, onions were eaten during church service in order to keep the churchgoers awake. Several types of onion have commonly been used as condiments in pickled herring dishes, spreads, sauces, foods made of blood and offal, dumplings, meat dishes and soups. Garlic was used for medicinal and magical purposes, as well as for ethnoveterinary medicine. Onion skins have traditionally been used for dyeing eggs at Easter. CONCLUSION: Genetic diversity of vegetables and garden crops represents a critical resource to achieve and maintain global food security. Therefore, ethnobiologists studying agricultural societies should place more focus on old landraces, cultivars and cultivation practices in order to understand the importance of garden crops for a society. They are an important element of sustainability. BioMed Central 2022-03-10 /pmc/articles/PMC8908593/ /pubmed/35272679 http://dx.doi.org/10.1186/s13002-022-00513-z Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research de Vahl, Erik Svanberg, Ingvar Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title | Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title_full | Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title_fullStr | Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title_full_unstemmed | Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title_short | Traditional uses and practices of edible cultivated Allium species (fam. Amaryllidaceae) in Sweden |
title_sort | traditional uses and practices of edible cultivated allium species (fam. amaryllidaceae) in sweden |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8908593/ https://www.ncbi.nlm.nih.gov/pubmed/35272679 http://dx.doi.org/10.1186/s13002-022-00513-z |
work_keys_str_mv | AT devahlerik traditionalusesandpracticesofediblecultivatedalliumspeciesfamamaryllidaceaeinsweden AT svanbergingvar traditionalusesandpracticesofediblecultivatedalliumspeciesfamamaryllidaceaeinsweden |