Cargando…

High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides

(1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD...

Descripción completa

Detalles Bibliográficos
Autores principales: Ueno, Shinji, Seino, Yusuke, Hidaka, Shihomi, Maekawa, Ryuya, Takano, Yuko, Yamamoto, Michiyo, Hori, Mika, Yokota, Kana, Masuda, Atsushi, Himeno, Tatsuhito, Tsunekawa, Shin, Kamiya, Hideki, Nakamura, Jiro, Kuwata, Hitoshi, Fujisawa, Haruki, Shibata, Megumi, Takayanagi, Takeshi, Sugimura, Yoshihisa, Yabe, Daisuke, Hayashi, Yoshitaka, Suzuki, Atsushi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8912298/
https://www.ncbi.nlm.nih.gov/pubmed/35267952
http://dx.doi.org/10.3390/nu14050975
_version_ 1784667084076089344
author Ueno, Shinji
Seino, Yusuke
Hidaka, Shihomi
Maekawa, Ryuya
Takano, Yuko
Yamamoto, Michiyo
Hori, Mika
Yokota, Kana
Masuda, Atsushi
Himeno, Tatsuhito
Tsunekawa, Shin
Kamiya, Hideki
Nakamura, Jiro
Kuwata, Hitoshi
Fujisawa, Haruki
Shibata, Megumi
Takayanagi, Takeshi
Sugimura, Yoshihisa
Yabe, Daisuke
Hayashi, Yoshitaka
Suzuki, Atsushi
author_facet Ueno, Shinji
Seino, Yusuke
Hidaka, Shihomi
Maekawa, Ryuya
Takano, Yuko
Yamamoto, Michiyo
Hori, Mika
Yokota, Kana
Masuda, Atsushi
Himeno, Tatsuhito
Tsunekawa, Shin
Kamiya, Hideki
Nakamura, Jiro
Kuwata, Hitoshi
Fujisawa, Haruki
Shibata, Megumi
Takayanagi, Takeshi
Sugimura, Yoshihisa
Yabe, Daisuke
Hayashi, Yoshitaka
Suzuki, Atsushi
author_sort Ueno, Shinji
collection PubMed
description (1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD feeding for 7 days was analyzed in mice deficient in proglucagon-derived peptides (GCGKO). (3) Results: In both control and GCGKO mice, food intake and body weight decreased with HPD and intestinal expression of Pepck increased. HPD also decreased plasma FGF21 levels, regardless of the presence of proglucagon-derived peptides. In control mice, HPD increased the hepatic expression of enzymes involved in amino acid metabolism without the elevation of plasma amino acid levels, except branched-chain amino acids. On the other hand, HPD-induced changes in the hepatic gene expression were attenuated in GCGKO mice, resulting in marked hyperaminoacidemia with lower blood glucose levels; the plasma concentration of glutamine exceeded that of glucose in HPD-fed GCGKO mice. (4) Conclusions: Increased plasma amino acid levels are a common feature in animal models with blocked GCG activity, and our results underscore that GCG plays essential roles in the homeostasis of amino acid metabolism in response to altered protein intake.
format Online
Article
Text
id pubmed-8912298
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-89122982022-03-11 High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides Ueno, Shinji Seino, Yusuke Hidaka, Shihomi Maekawa, Ryuya Takano, Yuko Yamamoto, Michiyo Hori, Mika Yokota, Kana Masuda, Atsushi Himeno, Tatsuhito Tsunekawa, Shin Kamiya, Hideki Nakamura, Jiro Kuwata, Hitoshi Fujisawa, Haruki Shibata, Megumi Takayanagi, Takeshi Sugimura, Yoshihisa Yabe, Daisuke Hayashi, Yoshitaka Suzuki, Atsushi Nutrients Article (1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD feeding for 7 days was analyzed in mice deficient in proglucagon-derived peptides (GCGKO). (3) Results: In both control and GCGKO mice, food intake and body weight decreased with HPD and intestinal expression of Pepck increased. HPD also decreased plasma FGF21 levels, regardless of the presence of proglucagon-derived peptides. In control mice, HPD increased the hepatic expression of enzymes involved in amino acid metabolism without the elevation of plasma amino acid levels, except branched-chain amino acids. On the other hand, HPD-induced changes in the hepatic gene expression were attenuated in GCGKO mice, resulting in marked hyperaminoacidemia with lower blood glucose levels; the plasma concentration of glutamine exceeded that of glucose in HPD-fed GCGKO mice. (4) Conclusions: Increased plasma amino acid levels are a common feature in animal models with blocked GCG activity, and our results underscore that GCG plays essential roles in the homeostasis of amino acid metabolism in response to altered protein intake. MDPI 2022-02-25 /pmc/articles/PMC8912298/ /pubmed/35267952 http://dx.doi.org/10.3390/nu14050975 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Ueno, Shinji
Seino, Yusuke
Hidaka, Shihomi
Maekawa, Ryuya
Takano, Yuko
Yamamoto, Michiyo
Hori, Mika
Yokota, Kana
Masuda, Atsushi
Himeno, Tatsuhito
Tsunekawa, Shin
Kamiya, Hideki
Nakamura, Jiro
Kuwata, Hitoshi
Fujisawa, Haruki
Shibata, Megumi
Takayanagi, Takeshi
Sugimura, Yoshihisa
Yabe, Daisuke
Hayashi, Yoshitaka
Suzuki, Atsushi
High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title_full High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title_fullStr High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title_full_unstemmed High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title_short High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
title_sort high protein diet feeding aggravates hyperaminoacidemia in mice deficient in proglucagon-derived peptides
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8912298/
https://www.ncbi.nlm.nih.gov/pubmed/35267952
http://dx.doi.org/10.3390/nu14050975
work_keys_str_mv AT uenoshinji highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT seinoyusuke highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT hidakashihomi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT maekawaryuya highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT takanoyuko highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT yamamotomichiyo highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT horimika highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT yokotakana highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT masudaatsushi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT himenotatsuhito highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT tsunekawashin highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT kamiyahideki highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT nakamurajiro highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT kuwatahitoshi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT fujisawaharuki highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT shibatamegumi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT takayanagitakeshi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT sugimurayoshihisa highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT yabedaisuke highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT hayashiyoshitaka highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides
AT suzukiatsushi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides