Cargando…
High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides
(1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD...
Autores principales: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8912298/ https://www.ncbi.nlm.nih.gov/pubmed/35267952 http://dx.doi.org/10.3390/nu14050975 |
_version_ | 1784667084076089344 |
---|---|
author | Ueno, Shinji Seino, Yusuke Hidaka, Shihomi Maekawa, Ryuya Takano, Yuko Yamamoto, Michiyo Hori, Mika Yokota, Kana Masuda, Atsushi Himeno, Tatsuhito Tsunekawa, Shin Kamiya, Hideki Nakamura, Jiro Kuwata, Hitoshi Fujisawa, Haruki Shibata, Megumi Takayanagi, Takeshi Sugimura, Yoshihisa Yabe, Daisuke Hayashi, Yoshitaka Suzuki, Atsushi |
author_facet | Ueno, Shinji Seino, Yusuke Hidaka, Shihomi Maekawa, Ryuya Takano, Yuko Yamamoto, Michiyo Hori, Mika Yokota, Kana Masuda, Atsushi Himeno, Tatsuhito Tsunekawa, Shin Kamiya, Hideki Nakamura, Jiro Kuwata, Hitoshi Fujisawa, Haruki Shibata, Megumi Takayanagi, Takeshi Sugimura, Yoshihisa Yabe, Daisuke Hayashi, Yoshitaka Suzuki, Atsushi |
author_sort | Ueno, Shinji |
collection | PubMed |
description | (1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD feeding for 7 days was analyzed in mice deficient in proglucagon-derived peptides (GCGKO). (3) Results: In both control and GCGKO mice, food intake and body weight decreased with HPD and intestinal expression of Pepck increased. HPD also decreased plasma FGF21 levels, regardless of the presence of proglucagon-derived peptides. In control mice, HPD increased the hepatic expression of enzymes involved in amino acid metabolism without the elevation of plasma amino acid levels, except branched-chain amino acids. On the other hand, HPD-induced changes in the hepatic gene expression were attenuated in GCGKO mice, resulting in marked hyperaminoacidemia with lower blood glucose levels; the plasma concentration of glutamine exceeded that of glucose in HPD-fed GCGKO mice. (4) Conclusions: Increased plasma amino acid levels are a common feature in animal models with blocked GCG activity, and our results underscore that GCG plays essential roles in the homeostasis of amino acid metabolism in response to altered protein intake. |
format | Online Article Text |
id | pubmed-8912298 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-89122982022-03-11 High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides Ueno, Shinji Seino, Yusuke Hidaka, Shihomi Maekawa, Ryuya Takano, Yuko Yamamoto, Michiyo Hori, Mika Yokota, Kana Masuda, Atsushi Himeno, Tatsuhito Tsunekawa, Shin Kamiya, Hideki Nakamura, Jiro Kuwata, Hitoshi Fujisawa, Haruki Shibata, Megumi Takayanagi, Takeshi Sugimura, Yoshihisa Yabe, Daisuke Hayashi, Yoshitaka Suzuki, Atsushi Nutrients Article (1) Background: Protein stimulates the secretion of glucagon (GCG), which can affect glucose metabolism. This study aimed to analyze the metabolic effect of a high-protein diet (HPD) in the presence or absence of proglucagon-derived peptides, including GCG and GLP-1. (2) Methods: The response to HPD feeding for 7 days was analyzed in mice deficient in proglucagon-derived peptides (GCGKO). (3) Results: In both control and GCGKO mice, food intake and body weight decreased with HPD and intestinal expression of Pepck increased. HPD also decreased plasma FGF21 levels, regardless of the presence of proglucagon-derived peptides. In control mice, HPD increased the hepatic expression of enzymes involved in amino acid metabolism without the elevation of plasma amino acid levels, except branched-chain amino acids. On the other hand, HPD-induced changes in the hepatic gene expression were attenuated in GCGKO mice, resulting in marked hyperaminoacidemia with lower blood glucose levels; the plasma concentration of glutamine exceeded that of glucose in HPD-fed GCGKO mice. (4) Conclusions: Increased plasma amino acid levels are a common feature in animal models with blocked GCG activity, and our results underscore that GCG plays essential roles in the homeostasis of amino acid metabolism in response to altered protein intake. MDPI 2022-02-25 /pmc/articles/PMC8912298/ /pubmed/35267952 http://dx.doi.org/10.3390/nu14050975 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Ueno, Shinji Seino, Yusuke Hidaka, Shihomi Maekawa, Ryuya Takano, Yuko Yamamoto, Michiyo Hori, Mika Yokota, Kana Masuda, Atsushi Himeno, Tatsuhito Tsunekawa, Shin Kamiya, Hideki Nakamura, Jiro Kuwata, Hitoshi Fujisawa, Haruki Shibata, Megumi Takayanagi, Takeshi Sugimura, Yoshihisa Yabe, Daisuke Hayashi, Yoshitaka Suzuki, Atsushi High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title | High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title_full | High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title_fullStr | High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title_full_unstemmed | High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title_short | High Protein Diet Feeding Aggravates Hyperaminoacidemia in Mice Deficient in Proglucagon-Derived Peptides |
title_sort | high protein diet feeding aggravates hyperaminoacidemia in mice deficient in proglucagon-derived peptides |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8912298/ https://www.ncbi.nlm.nih.gov/pubmed/35267952 http://dx.doi.org/10.3390/nu14050975 |
work_keys_str_mv | AT uenoshinji highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT seinoyusuke highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT hidakashihomi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT maekawaryuya highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT takanoyuko highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT yamamotomichiyo highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT horimika highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT yokotakana highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT masudaatsushi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT himenotatsuhito highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT tsunekawashin highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT kamiyahideki highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT nakamurajiro highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT kuwatahitoshi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT fujisawaharuki highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT shibatamegumi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT takayanagitakeshi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT sugimurayoshihisa highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT yabedaisuke highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT hayashiyoshitaka highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides AT suzukiatsushi highproteindietfeedingaggravateshyperaminoacidemiainmicedeficientinproglucagonderivedpeptides |