Cargando…
Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on th...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8913950/ https://www.ncbi.nlm.nih.gov/pubmed/31424537 http://dx.doi.org/10.3382/ps/pez477 |
_version_ | 1784667576680316928 |
---|---|
author | Zhuang, Jionghan Nie, Gaohui Yang, Fan Cao, Huabin Xing, Chenghong Dai, Xueyan Hu, Guoliang Zhang, Caiying |
author_facet | Zhuang, Jionghan Nie, Gaohui Yang, Fan Cao, Huabin Xing, Chenghong Dai, Xueyan Hu, Guoliang Zhang, Caiying |
author_sort | Zhuang, Jionghan |
collection | PubMed |
description | To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on the basal diet for 120 d. Kidney samples were collected on day 120 to determine the mRNA expression levels of adenosine 5′-monophosphate (AMP)-activated protein kinase α1 (AMPKα1), mammalian target of rapamycin (mTOR), Beclin-1, autophagy-related gene-5 (Atg5), microtubule-associated protein light chain A (LC3A), microtubule-associated protein light chain B (LC3B), sequestosome-1, and Dynein by real-time quantitative polymerase chain reaction. Meanwhile, ultrastructural changes of the kidney were observed. The results indicated that the mTOR and P62 mRNA expression levels were significantly downregulated, but the Atg5 and Beclin-1 mRNA levels were remarkably upregulated in all treated groups compared to control group, and their changes were greater in joint groups. Additionally, compared to control group, the Dynein mRNA expression level was apparently downregulated in co-treated groups, the LC3B, LC3A, and AMPKα1 expression levels were dramatically upregulated in single treated groups and they were not obviously different in co-treated groups. Ultrastructural changes showed that Mo and Cd could markedly increase the number of autophagosomes. Taken together, it suggested that dietary Mo and Cd might induce autophagy via AMPK/mTOR signaling pathway in duck kidney, and it showed a possible synergistic relationship between the 2 elements. |
format | Online Article Text |
id | pubmed-8913950 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-89139502022-03-12 Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney Zhuang, Jionghan Nie, Gaohui Yang, Fan Cao, Huabin Xing, Chenghong Dai, Xueyan Hu, Guoliang Zhang, Caiying Poult Sci Article To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on the basal diet for 120 d. Kidney samples were collected on day 120 to determine the mRNA expression levels of adenosine 5′-monophosphate (AMP)-activated protein kinase α1 (AMPKα1), mammalian target of rapamycin (mTOR), Beclin-1, autophagy-related gene-5 (Atg5), microtubule-associated protein light chain A (LC3A), microtubule-associated protein light chain B (LC3B), sequestosome-1, and Dynein by real-time quantitative polymerase chain reaction. Meanwhile, ultrastructural changes of the kidney were observed. The results indicated that the mTOR and P62 mRNA expression levels were significantly downregulated, but the Atg5 and Beclin-1 mRNA levels were remarkably upregulated in all treated groups compared to control group, and their changes were greater in joint groups. Additionally, compared to control group, the Dynein mRNA expression level was apparently downregulated in co-treated groups, the LC3B, LC3A, and AMPKα1 expression levels were dramatically upregulated in single treated groups and they were not obviously different in co-treated groups. Ultrastructural changes showed that Mo and Cd could markedly increase the number of autophagosomes. Taken together, it suggested that dietary Mo and Cd might induce autophagy via AMPK/mTOR signaling pathway in duck kidney, and it showed a possible synergistic relationship between the 2 elements. Elsevier 2019-12-17 /pmc/articles/PMC8913950/ /pubmed/31424537 http://dx.doi.org/10.3382/ps/pez477 Text en © 2019 Poultry Science Association Inc. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Article Zhuang, Jionghan Nie, Gaohui Yang, Fan Cao, Huabin Xing, Chenghong Dai, Xueyan Hu, Guoliang Zhang, Caiying Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title | Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title_full | Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title_fullStr | Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title_full_unstemmed | Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title_short | Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney |
title_sort | molybdenum and cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in shaoxing duck (anas platyrhyncha) kidney |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8913950/ https://www.ncbi.nlm.nih.gov/pubmed/31424537 http://dx.doi.org/10.3382/ps/pez477 |
work_keys_str_mv | AT zhuangjionghan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT niegaohui molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT yangfan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT caohuabin molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT xingchenghong molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT daixueyan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT huguoliang molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney AT zhangcaiying molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney |