Cargando…

Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney

To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on th...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhuang, Jionghan, Nie, Gaohui, Yang, Fan, Cao, Huabin, Xing, Chenghong, Dai, Xueyan, Hu, Guoliang, Zhang, Caiying
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8913950/
https://www.ncbi.nlm.nih.gov/pubmed/31424537
http://dx.doi.org/10.3382/ps/pez477
_version_ 1784667576680316928
author Zhuang, Jionghan
Nie, Gaohui
Yang, Fan
Cao, Huabin
Xing, Chenghong
Dai, Xueyan
Hu, Guoliang
Zhang, Caiying
author_facet Zhuang, Jionghan
Nie, Gaohui
Yang, Fan
Cao, Huabin
Xing, Chenghong
Dai, Xueyan
Hu, Guoliang
Zhang, Caiying
author_sort Zhuang, Jionghan
collection PubMed
description To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on the basal diet for 120 d. Kidney samples were collected on day 120 to determine the mRNA expression levels of adenosine 5′-monophosphate (AMP)-activated protein kinase α1 (AMPKα1), mammalian target of rapamycin (mTOR), Beclin-1, autophagy-related gene-5 (Atg5), microtubule-associated protein light chain A (LC3A), microtubule-associated protein light chain B (LC3B), sequestosome-1, and Dynein by real-time quantitative polymerase chain reaction. Meanwhile, ultrastructural changes of the kidney were observed. The results indicated that the mTOR and P62 mRNA expression levels were significantly downregulated, but the Atg5 and Beclin-1 mRNA levels were remarkably upregulated in all treated groups compared to control group, and their changes were greater in joint groups. Additionally, compared to control group, the Dynein mRNA expression level was apparently downregulated in co-treated groups, the LC3B, LC3A, and AMPKα1 expression levels were dramatically upregulated in single treated groups and they were not obviously different in co-treated groups. Ultrastructural changes showed that Mo and Cd could markedly increase the number of autophagosomes. Taken together, it suggested that dietary Mo and Cd might induce autophagy via AMPK/mTOR signaling pathway in duck kidney, and it showed a possible synergistic relationship between the 2 elements.
format Online
Article
Text
id pubmed-8913950
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-89139502022-03-12 Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney Zhuang, Jionghan Nie, Gaohui Yang, Fan Cao, Huabin Xing, Chenghong Dai, Xueyan Hu, Guoliang Zhang, Caiying Poult Sci Article To investigate Molybdenum (Mo) and Cadmium (Cd) co-induced the levels of autophagy-related genes via AMPK/mTOR signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney, 60 healthy 11-day-old ducks were randomly divided into 6 groups, which were treated with Mo or/and Cd at different doses on the basal diet for 120 d. Kidney samples were collected on day 120 to determine the mRNA expression levels of adenosine 5′-monophosphate (AMP)-activated protein kinase α1 (AMPKα1), mammalian target of rapamycin (mTOR), Beclin-1, autophagy-related gene-5 (Atg5), microtubule-associated protein light chain A (LC3A), microtubule-associated protein light chain B (LC3B), sequestosome-1, and Dynein by real-time quantitative polymerase chain reaction. Meanwhile, ultrastructural changes of the kidney were observed. The results indicated that the mTOR and P62 mRNA expression levels were significantly downregulated, but the Atg5 and Beclin-1 mRNA levels were remarkably upregulated in all treated groups compared to control group, and their changes were greater in joint groups. Additionally, compared to control group, the Dynein mRNA expression level was apparently downregulated in co-treated groups, the LC3B, LC3A, and AMPKα1 expression levels were dramatically upregulated in single treated groups and they were not obviously different in co-treated groups. Ultrastructural changes showed that Mo and Cd could markedly increase the number of autophagosomes. Taken together, it suggested that dietary Mo and Cd might induce autophagy via AMPK/mTOR signaling pathway in duck kidney, and it showed a possible synergistic relationship between the 2 elements. Elsevier 2019-12-17 /pmc/articles/PMC8913950/ /pubmed/31424537 http://dx.doi.org/10.3382/ps/pez477 Text en © 2019 Poultry Science Association Inc. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Article
Zhuang, Jionghan
Nie, Gaohui
Yang, Fan
Cao, Huabin
Xing, Chenghong
Dai, Xueyan
Hu, Guoliang
Zhang, Caiying
Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title_full Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title_fullStr Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title_full_unstemmed Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title_short Molybdenum and Cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in Shaoxing Duck (Anas platyrhyncha) kidney
title_sort molybdenum and cadmium co-induced the levels of autophagy-related genes via adenosine 5′-monophosphate-activated protein kinase/mammalian target of rapamycin signaling pathway in shaoxing duck (anas platyrhyncha) kidney
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8913950/
https://www.ncbi.nlm.nih.gov/pubmed/31424537
http://dx.doi.org/10.3382/ps/pez477
work_keys_str_mv AT zhuangjionghan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT niegaohui molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT yangfan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT caohuabin molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT xingchenghong molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT daixueyan molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT huguoliang molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney
AT zhangcaiying molybdenumandcadmiumcoinducedthelevelsofautophagyrelatedgenesviaadenosine5monophosphateactivatedproteinkinasemammaliantargetofrapamycinsignalingpathwayinshaoxingduckanasplatyrhynchakidney