Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony

The current prevalence of avian leukosis virus (ALV) in fancy chickens in Germany is unknown. Therefore, 537 cloacal swabs from 50 purebred fancy-chicken flocks in Saxony were tested for the presence of the ALV p27 protein using a commercial antigen-capture ELISA. The detection rate was 28.7% at the...

Descripción completa

Detalles Bibliográficos
Autores principales: Freick, Markus, Schreiter, Ruben, Weber, Jim, Vahlenkamp, Thomas W., Heenemann, Kristin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Vienna 2022
Materias:
Brief Report
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8964621/
https://www.ncbi.nlm.nih.gov/pubmed/35301570
http://dx.doi.org/10.1007/s00705-022-05404-y
_version_ 1784678258239864832
author Freick, Markus
Schreiter, Ruben
Weber, Jim
Vahlenkamp, Thomas W.
Heenemann, Kristin
author_facet Freick, Markus
Schreiter, Ruben
Weber, Jim
Vahlenkamp, Thomas W.
Heenemann, Kristin
author_sort Freick, Markus
collection PubMed
description The current prevalence of avian leukosis virus (ALV) in fancy chickens in Germany is unknown. Therefore, 537 cloacal swabs from 50 purebred fancy-chicken flocks in Saxony were tested for the presence of the ALV p27 protein using a commercial antigen-capture ELISA. The detection rate was 28.7% at the individual-animal level and 56.0% at the flock level. Phylogenetic analysis of PCR products obtained from 22 different flocks revealed the highest similarity to ALV subtype K. When classifying breeds by their origin, ALV detection rates differed significantly. Evaluation of questionnaire data revealed no significant differences between ALV-positive and negative flocks regarding mortality. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00705-022-05404-y.
format Online
Article
Text
id pubmed-8964621
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Springer Vienna
record_format MEDLINE/PubMed
spelling pubmed-89646212022-04-07 Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony Freick, Markus Schreiter, Ruben Weber, Jim Vahlenkamp, Thomas W. Heenemann, Kristin Arch Virol Brief Report The current prevalence of avian leukosis virus (ALV) in fancy chickens in Germany is unknown. Therefore, 537 cloacal swabs from 50 purebred fancy-chicken flocks in Saxony were tested for the presence of the ALV p27 protein using a commercial antigen-capture ELISA. The detection rate was 28.7% at the individual-animal level and 56.0% at the flock level. Phylogenetic analysis of PCR products obtained from 22 different flocks revealed the highest similarity to ALV subtype K. When classifying breeds by their origin, ALV detection rates differed significantly. Evaluation of questionnaire data revealed no significant differences between ALV-positive and negative flocks regarding mortality. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00705-022-05404-y. Springer Vienna 2022-03-17 2022 /pmc/articles/PMC8964621/ /pubmed/35301570 http://dx.doi.org/10.1007/s00705-022-05404-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Brief Report
Freick, Markus
Schreiter, Ruben
Weber, Jim
Vahlenkamp, Thomas W.
Heenemann, Kristin
Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title_full Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title_fullStr Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title_full_unstemmed Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title_short Avian leukosis virus (ALV) is highly prevalent in fancy-chicken flocks in Saxony
title_sort avian leukosis virus (alv) is highly prevalent in fancy-chicken flocks in saxony
topic Brief Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8964621/
https://www.ncbi.nlm.nih.gov/pubmed/35301570
http://dx.doi.org/10.1007/s00705-022-05404-y
work_keys_str_mv AT freickmarkus avianleukosisvirusalvishighlyprevalentinfancychickenflocksinsaxony
AT schreiterruben avianleukosisvirusalvishighlyprevalentinfancychickenflocksinsaxony
AT weberjim avianleukosisvirusalvishighlyprevalentinfancychickenflocksinsaxony
AT vahlenkampthomasw avianleukosisvirusalvishighlyprevalentinfancychickenflocksinsaxony
AT heenemannkristin avianleukosisvirusalvishighlyprevalentinfancychickenflocksinsaxony

Ejemplares similares