Cargando…
Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients
| Autores principales: | , , , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
International Society of Nephrology. Published by Elsevier Inc.
2022
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9006415/ https://www.ncbi.nlm.nih.gov/pubmed/35429496 http://dx.doi.org/10.1016/j.kint.2022.04.009 |
| _version_ | 1784686660977426432 |
|---|---|
| author | Al Jurdi, Ayman Gassen, Rodrigo B. Borges, Thiago J. Lape, Isadora T. Morena, Leela Efe, Orhan Solhjou, Zhabiz El Fekih, Rania Deban, Christa Bohan, Brigid Pattanayak, Vikram Kotton, Camille N. Azzi, Jamil R. Riella, Leonardo V. |
| author_facet | Al Jurdi, Ayman Gassen, Rodrigo B. Borges, Thiago J. Lape, Isadora T. Morena, Leela Efe, Orhan Solhjou, Zhabiz El Fekih, Rania Deban, Christa Bohan, Brigid Pattanayak, Vikram Kotton, Camille N. Azzi, Jamil R. Riella, Leonardo V. |
| author_sort | Al Jurdi, Ayman |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-9006415 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2022 |
| publisher | International Society of Nephrology. Published by Elsevier Inc. |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-90064152022-04-13 Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients Al Jurdi, Ayman Gassen, Rodrigo B. Borges, Thiago J. Lape, Isadora T. Morena, Leela Efe, Orhan Solhjou, Zhabiz El Fekih, Rania Deban, Christa Bohan, Brigid Pattanayak, Vikram Kotton, Camille N. Azzi, Jamil R. Riella, Leonardo V. Kidney Int Research Letter International Society of Nephrology. Published by Elsevier Inc. 2022-06 2022-04-13 /pmc/articles/PMC9006415/ /pubmed/35429496 http://dx.doi.org/10.1016/j.kint.2022.04.009 Text en © 2022 International Society of Nephrology. Published by Elsevier Inc. All rights reserved. Since January 2020 Elsevier has created a COVID-19 resource centre with free information in English and Mandarin on the novel coronavirus COVID-19. The COVID-19 resource centre is hosted on Elsevier Connect, the company's public news and information website. Elsevier hereby grants permission to make all its COVID-19-related research that is available on the COVID-19 resource centre - including this research content - immediately available in PubMed Central and other publicly funded repositories, such as the WHO COVID database with rights for unrestricted research re-use and analyses in any form or by any means with acknowledgement of the original source. These permissions are granted for free by Elsevier for as long as the COVID-19 resource centre remains active. |
| spellingShingle | Research Letter Al Jurdi, Ayman Gassen, Rodrigo B. Borges, Thiago J. Lape, Isadora T. Morena, Leela Efe, Orhan Solhjou, Zhabiz El Fekih, Rania Deban, Christa Bohan, Brigid Pattanayak, Vikram Kotton, Camille N. Azzi, Jamil R. Riella, Leonardo V. Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title | Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title_full | Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title_fullStr | Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title_full_unstemmed | Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title_short | Suboptimal antibody response against SARS-CoV-2 Omicron variant after third dose of mRNA vaccine in kidney transplant recipients |
| title_sort | suboptimal antibody response against sars-cov-2 omicron variant after third dose of mrna vaccine in kidney transplant recipients |
| topic | Research Letter |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9006415/ https://www.ncbi.nlm.nih.gov/pubmed/35429496 http://dx.doi.org/10.1016/j.kint.2022.04.009 |
| work_keys_str_mv | AT aljurdiayman suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT gassenrodrigob suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT borgesthiagoj suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT lapeisadorat suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT morenaleela suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT efeorhan suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT solhjouzhabiz suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT elfekihrania suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT debanchrista suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT bohanbrigid suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT pattanayakvikram suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT kottoncamillen suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT azzijamilr suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients AT riellaleonardov suboptimalantibodyresponseagainstsarscov2omicronvariantafterthirddoseofmrnavaccineinkidneytransplantrecipients |