Cargando…
Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16
BACKGROUND: Demand for family planning is predominantly for birth limiting rather than birth spacing in India. Despite several family planning programmes in India, the use of reversible contraception for limiting family planning has been stagnant and largely depends on female sterilization. Though m...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9020013/ https://www.ncbi.nlm.nih.gov/pubmed/35439954 http://dx.doi.org/10.1186/s12905-022-01706-0 |
_version_ | 1784689433241452544 |
---|---|
author | Rahaman, Margubur Singh, Risha Chouhan, Pradip Roy, Avijit Ajmer, Sumela Rana, Md Juel |
author_facet | Rahaman, Margubur Singh, Risha Chouhan, Pradip Roy, Avijit Ajmer, Sumela Rana, Md Juel |
author_sort | Rahaman, Margubur |
collection | PubMed |
description | BACKGROUND: Demand for family planning is predominantly for birth limiting rather than birth spacing in India. Despite several family planning programmes in India, the use of reversible contraception for limiting family planning has been stagnant and largely depends on female sterilization. Though many researchers have examined patterns and determinants of using modern contraception for total family planning, studies on patterns and determinants of contraceptive use for birth limiting are limited in India. This paper examines the patterns of contraceptive use for liming demand and its determinants in India. METHODS: The National Family Health Survey-4, 2015–16 data was used. Bivariate chi-square significant test and multivariate binary logistic regression model used to accomplish the study objectives. RESULTS: Majority of women (86.5%) satisfied limiting demand (SLD) in India; the SLD was found significantly low among the women’s age 15–19 years (53.1%) and parity 0 (42%). The satisfied limiting demand by modern reversible contraception (mrSLD) was found significantly high in age group 15–19 years (49.1%), Muslims (30.6%) and North-east region (45.4%). The satisfied limiting demand by traditional contraception (tSLD) was almost three times higher in North-east region (26.1%) than national average of India (8.7%). The women’s years of schooling, wealth status, religion and presence of son child found to be significant determinants of mrSLD. The likelihood of tSLD was found significantly high among the women who had no son child (AOR = 1.41; 95% CI:1.34, 1.48), Muslim (AOR = 1.78; 95% CI:1.70, 1.87). A considerable regional variability in levels of SLD, mrSLD and tSLD was found in India. CONCLUSION: Public investment in family planning is required to promote and provide subsidized modern reversible contraception (MRC) services, especially to women from North-east region, Muslim, Scheduled tribe, poor household and who had no son child. Improving the quality and availability of MRC services in public health centre will be helpful to increase SLD among the above mentioned women. Besides, the promotion of MRC will be supportive to overcome the issues of sterilization regrets in India. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12905-022-01706-0. |
format | Online Article Text |
id | pubmed-9020013 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-90200132022-04-21 Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 Rahaman, Margubur Singh, Risha Chouhan, Pradip Roy, Avijit Ajmer, Sumela Rana, Md Juel BMC Womens Health Research BACKGROUND: Demand for family planning is predominantly for birth limiting rather than birth spacing in India. Despite several family planning programmes in India, the use of reversible contraception for limiting family planning has been stagnant and largely depends on female sterilization. Though many researchers have examined patterns and determinants of using modern contraception for total family planning, studies on patterns and determinants of contraceptive use for birth limiting are limited in India. This paper examines the patterns of contraceptive use for liming demand and its determinants in India. METHODS: The National Family Health Survey-4, 2015–16 data was used. Bivariate chi-square significant test and multivariate binary logistic regression model used to accomplish the study objectives. RESULTS: Majority of women (86.5%) satisfied limiting demand (SLD) in India; the SLD was found significantly low among the women’s age 15–19 years (53.1%) and parity 0 (42%). The satisfied limiting demand by modern reversible contraception (mrSLD) was found significantly high in age group 15–19 years (49.1%), Muslims (30.6%) and North-east region (45.4%). The satisfied limiting demand by traditional contraception (tSLD) was almost three times higher in North-east region (26.1%) than national average of India (8.7%). The women’s years of schooling, wealth status, religion and presence of son child found to be significant determinants of mrSLD. The likelihood of tSLD was found significantly high among the women who had no son child (AOR = 1.41; 95% CI:1.34, 1.48), Muslim (AOR = 1.78; 95% CI:1.70, 1.87). A considerable regional variability in levels of SLD, mrSLD and tSLD was found in India. CONCLUSION: Public investment in family planning is required to promote and provide subsidized modern reversible contraception (MRC) services, especially to women from North-east region, Muslim, Scheduled tribe, poor household and who had no son child. Improving the quality and availability of MRC services in public health centre will be helpful to increase SLD among the above mentioned women. Besides, the promotion of MRC will be supportive to overcome the issues of sterilization regrets in India. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12905-022-01706-0. BioMed Central 2022-04-19 /pmc/articles/PMC9020013/ /pubmed/35439954 http://dx.doi.org/10.1186/s12905-022-01706-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Rahaman, Margubur Singh, Risha Chouhan, Pradip Roy, Avijit Ajmer, Sumela Rana, Md Juel Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title | Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title_full | Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title_fullStr | Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title_full_unstemmed | Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title_short | Levels, patterns and determinants of using reversible contraceptives for limiting family planning in India: evidence from National Family Health Survey, 2015–16 |
title_sort | levels, patterns and determinants of using reversible contraceptives for limiting family planning in india: evidence from national family health survey, 2015–16 |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9020013/ https://www.ncbi.nlm.nih.gov/pubmed/35439954 http://dx.doi.org/10.1186/s12905-022-01706-0 |
work_keys_str_mv | AT rahamanmargubur levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 AT singhrisha levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 AT chouhanpradip levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 AT royavijit levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 AT ajmersumela levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 AT ranamdjuel levelspatternsanddeterminantsofusingreversiblecontraceptivesforlimitingfamilyplanninginindiaevidencefromnationalfamilyhealthsurvey201516 |