Cargando…

Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)

As highly conserved signaling pathway modules, mitogen-activated protein kinase (MAPK) cascades play vital roles in a diverse range of stress and hormonal responses in plants. Among the established components of MAPK cascades, Raf-like MAPK kinase kinases (MAPKKKs) are associated with abscisic acid...

Descripción completa

Detalles Bibliográficos
Autores principales: Lim, Chae Woo, Lee, Sung Chul
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9037509/
https://www.ncbi.nlm.nih.gov/pubmed/35435138
http://dx.doi.org/10.1080/15592324.2022.2064647
_version_ 1784693739735744512
author Lim, Chae Woo
Lee, Sung Chul
author_facet Lim, Chae Woo
Lee, Sung Chul
author_sort Lim, Chae Woo
collection PubMed
description As highly conserved signaling pathway modules, mitogen-activated protein kinase (MAPK) cascades play vital roles in a diverse range of stress and hormonal responses in plants. Among the established components of MAPK cascades, Raf-like MAPK kinase kinases (MAPKKKs) are associated with abscisic acid (ABA) signaling and osmotic stress responses. However, despite the availability of a pepper reference genome, few of the Raf-like kinases in pepper plants have been functionally characterized. In this study, we isolated 47 putative Raf-like kinase genes from the pepper genome based on in silico analysis, which were classified into two major categories, namely, groups B and C (further sub-grouped into B1–B4 and C1–C7, respectively) and named sequentially as CaRaf1 to CaRaf47. Subcellular localization prediction analysis revealed that most of the group B CaRaf-like kinases are probably nuclear-localized, whereas a majority of group C members targeted into the cytoplasm. Transcriptional regulation of the 47 CaRaf genes in response to treatment with ABA, drought, NaCl, and mannitol was quantitatively analyzed by reverse-transcription PCR analysis. This revealed a significant induction of subgroup B3, C2, C3, and C5 members, indicating that these genes may be functionally associated with the response to osmotic stress, mediated via both ABA-dependent and -independent pathways. The findings of this study can accordingly serve as a basis for the identification of CaRaf genes associated with the regulation of ABA signaling and osmotic stress response and thus contribute to enhancing our understanding of the biological functions of CaRaf kinases in the responses of plants to different abiotic stresses.
format Online
Article
Text
id pubmed-9037509
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-90375092022-04-26 Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.) Lim, Chae Woo Lee, Sung Chul Plant Signal Behav Short Communication As highly conserved signaling pathway modules, mitogen-activated protein kinase (MAPK) cascades play vital roles in a diverse range of stress and hormonal responses in plants. Among the established components of MAPK cascades, Raf-like MAPK kinase kinases (MAPKKKs) are associated with abscisic acid (ABA) signaling and osmotic stress responses. However, despite the availability of a pepper reference genome, few of the Raf-like kinases in pepper plants have been functionally characterized. In this study, we isolated 47 putative Raf-like kinase genes from the pepper genome based on in silico analysis, which were classified into two major categories, namely, groups B and C (further sub-grouped into B1–B4 and C1–C7, respectively) and named sequentially as CaRaf1 to CaRaf47. Subcellular localization prediction analysis revealed that most of the group B CaRaf-like kinases are probably nuclear-localized, whereas a majority of group C members targeted into the cytoplasm. Transcriptional regulation of the 47 CaRaf genes in response to treatment with ABA, drought, NaCl, and mannitol was quantitatively analyzed by reverse-transcription PCR analysis. This revealed a significant induction of subgroup B3, C2, C3, and C5 members, indicating that these genes may be functionally associated with the response to osmotic stress, mediated via both ABA-dependent and -independent pathways. The findings of this study can accordingly serve as a basis for the identification of CaRaf genes associated with the regulation of ABA signaling and osmotic stress response and thus contribute to enhancing our understanding of the biological functions of CaRaf kinases in the responses of plants to different abiotic stresses. Taylor & Francis 2022-04-17 /pmc/articles/PMC9037509/ /pubmed/35435138 http://dx.doi.org/10.1080/15592324.2022.2064647 Text en © 2022 The Author(s). Published with license by Taylor & Francis Group, LLC. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Short Communication
Lim, Chae Woo
Lee, Sung Chul
Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title_full Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title_fullStr Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title_full_unstemmed Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title_short Genome-wide identification and expression analysis of Raf-like kinase gene family in pepper (Capsicum annuum L.)
title_sort genome-wide identification and expression analysis of raf-like kinase gene family in pepper (capsicum annuum l.)
topic Short Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9037509/
https://www.ncbi.nlm.nih.gov/pubmed/35435138
http://dx.doi.org/10.1080/15592324.2022.2064647
work_keys_str_mv AT limchaewoo genomewideidentificationandexpressionanalysisofraflikekinasegenefamilyinpeppercapsicumannuuml
AT leesungchul genomewideidentificationandexpressionanalysisofraflikekinasegenefamilyinpeppercapsicumannuuml