Cargando…
Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communitie...
Autores principales: | , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9045619/ https://www.ncbi.nlm.nih.gov/pubmed/35476709 http://dx.doi.org/10.1371/journal.pone.0263316 |
_version_ | 1784695354221920256 |
---|---|
author | Lerdsamran, Hatairat Mungaomklang, Anek Iamsirithaworn, Sopon Prasertsopon, Jarunee Wiriyarat, Witthawat Saritsiri, Suthee Anusorntanawat, Ratikorn Siriyakorn, Nirada Intalapaporn, Poj Sirikhetkon, Somrak Sangsiriwut, Kantima Dangsakul, Worawat Sawadpongpan, Suteema Thinpan, Nattakan Kitidee, Kuntida Okada, Pilailuk Techasuwanna, Ranida Mongkalangoon, Noparat Prasert, Kriengkrai Puthavathana, Pilaipan |
author_facet | Lerdsamran, Hatairat Mungaomklang, Anek Iamsirithaworn, Sopon Prasertsopon, Jarunee Wiriyarat, Witthawat Saritsiri, Suthee Anusorntanawat, Ratikorn Siriyakorn, Nirada Intalapaporn, Poj Sirikhetkon, Somrak Sangsiriwut, Kantima Dangsakul, Worawat Sawadpongpan, Suteema Thinpan, Nattakan Kitidee, Kuntida Okada, Pilailuk Techasuwanna, Ranida Mongkalangoon, Noparat Prasert, Kriengkrai Puthavathana, Pilaipan |
author_sort | Lerdsamran, Hatairat |
collection | PubMed |
description | This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, and 553 Thai citizens returning after spending extended periods of time in countries with a high disease prevalence. We recruited participants between May 2020 and May 2021, which spanned the first two epidemic waves and part of the third wave of the COVID-19 outbreaks in Thailand. Their sera were tested in a microneutralization and a chemiluminescence immunoassay for IgG against the N protein. Furthermore, we performed an immunofluorescence assay to resolve discordant results between the two assays. None of the prepandemic sera contained anti-SARS-CoV-2 antibodies, while antibodies developed in 88% (15 of 17) of the COVID-19 patients at 8–14 days and in 94–100% of the patients between 15 and 60 days after disease onset. Neutralizing antibodies persisted for at least 8 months, longer than IgG antibodies. Of the 2113 individuals at risk due to their occupation, none of the health providers, airport officers, or public transport drivers were seropositive, while antibodies were present in 0.44% of entertainment workers. Among the 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, seropositivity was present in 1.9, 1.5, and 7.5% of the Bangkok residents during the three epidemic waves, respectively, and in 1.3% of the Chiang Mai people during the first epidemic wave. The antibody prevalence varied between 6.5 and 47.0% in 553 Thai people returning from high-risk countries. This serosurveillance study found a low infection rate of SARS-CoV-2 in Thailand before the emergence of the Delta variant in late May 2021. The findings support the Ministry of Public Health’s data, which are based on numbers of patients and contact tracing. |
format | Online Article Text |
id | pubmed-9045619 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-90456192022-04-28 Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves Lerdsamran, Hatairat Mungaomklang, Anek Iamsirithaworn, Sopon Prasertsopon, Jarunee Wiriyarat, Witthawat Saritsiri, Suthee Anusorntanawat, Ratikorn Siriyakorn, Nirada Intalapaporn, Poj Sirikhetkon, Somrak Sangsiriwut, Kantima Dangsakul, Worawat Sawadpongpan, Suteema Thinpan, Nattakan Kitidee, Kuntida Okada, Pilailuk Techasuwanna, Ranida Mongkalangoon, Noparat Prasert, Kriengkrai Puthavathana, Pilaipan PLoS One Research Article This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, and 553 Thai citizens returning after spending extended periods of time in countries with a high disease prevalence. We recruited participants between May 2020 and May 2021, which spanned the first two epidemic waves and part of the third wave of the COVID-19 outbreaks in Thailand. Their sera were tested in a microneutralization and a chemiluminescence immunoassay for IgG against the N protein. Furthermore, we performed an immunofluorescence assay to resolve discordant results between the two assays. None of the prepandemic sera contained anti-SARS-CoV-2 antibodies, while antibodies developed in 88% (15 of 17) of the COVID-19 patients at 8–14 days and in 94–100% of the patients between 15 and 60 days after disease onset. Neutralizing antibodies persisted for at least 8 months, longer than IgG antibodies. Of the 2113 individuals at risk due to their occupation, none of the health providers, airport officers, or public transport drivers were seropositive, while antibodies were present in 0.44% of entertainment workers. Among the 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, seropositivity was present in 1.9, 1.5, and 7.5% of the Bangkok residents during the three epidemic waves, respectively, and in 1.3% of the Chiang Mai people during the first epidemic wave. The antibody prevalence varied between 6.5 and 47.0% in 553 Thai people returning from high-risk countries. This serosurveillance study found a low infection rate of SARS-CoV-2 in Thailand before the emergence of the Delta variant in late May 2021. The findings support the Ministry of Public Health’s data, which are based on numbers of patients and contact tracing. Public Library of Science 2022-04-27 /pmc/articles/PMC9045619/ /pubmed/35476709 http://dx.doi.org/10.1371/journal.pone.0263316 Text en © 2022 Lerdsamran et al https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Lerdsamran, Hatairat Mungaomklang, Anek Iamsirithaworn, Sopon Prasertsopon, Jarunee Wiriyarat, Witthawat Saritsiri, Suthee Anusorntanawat, Ratikorn Siriyakorn, Nirada Intalapaporn, Poj Sirikhetkon, Somrak Sangsiriwut, Kantima Dangsakul, Worawat Sawadpongpan, Suteema Thinpan, Nattakan Kitidee, Kuntida Okada, Pilailuk Techasuwanna, Ranida Mongkalangoon, Noparat Prasert, Kriengkrai Puthavathana, Pilaipan Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title | Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title_full | Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title_fullStr | Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title_full_unstemmed | Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title_short | Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves |
title_sort | seroprevalence of anti-sars-cov-2 antibodies in thai adults during the first three epidemic waves |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9045619/ https://www.ncbi.nlm.nih.gov/pubmed/35476709 http://dx.doi.org/10.1371/journal.pone.0263316 |
work_keys_str_mv | AT lerdsamranhatairat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT mungaomklanganek seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT iamsirithawornsopon seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT prasertsoponjarunee seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT wiriyaratwitthawat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT saritsirisuthee seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT anusorntanawatratikorn seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT siriyakornnirada seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT intalapapornpoj seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT sirikhetkonsomrak seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT sangsiriwutkantima seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT dangsakulworawat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT sawadpongpansuteema seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT thinpannattakan seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT kitideekuntida seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT okadapilailuk seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT techasuwannaranida seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT mongkalangoonnoparat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT prasertkriengkrai seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves AT puthavathanapilaipan seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves |