Cargando…

Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves

This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communitie...

Descripción completa

Detalles Bibliográficos
Autores principales: Lerdsamran, Hatairat, Mungaomklang, Anek, Iamsirithaworn, Sopon, Prasertsopon, Jarunee, Wiriyarat, Witthawat, Saritsiri, Suthee, Anusorntanawat, Ratikorn, Siriyakorn, Nirada, Intalapaporn, Poj, Sirikhetkon, Somrak, Sangsiriwut, Kantima, Dangsakul, Worawat, Sawadpongpan, Suteema, Thinpan, Nattakan, Kitidee, Kuntida, Okada, Pilailuk, Techasuwanna, Ranida, Mongkalangoon, Noparat, Prasert, Kriengkrai, Puthavathana, Pilaipan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9045619/
https://www.ncbi.nlm.nih.gov/pubmed/35476709
http://dx.doi.org/10.1371/journal.pone.0263316
_version_ 1784695354221920256
author Lerdsamran, Hatairat
Mungaomklang, Anek
Iamsirithaworn, Sopon
Prasertsopon, Jarunee
Wiriyarat, Witthawat
Saritsiri, Suthee
Anusorntanawat, Ratikorn
Siriyakorn, Nirada
Intalapaporn, Poj
Sirikhetkon, Somrak
Sangsiriwut, Kantima
Dangsakul, Worawat
Sawadpongpan, Suteema
Thinpan, Nattakan
Kitidee, Kuntida
Okada, Pilailuk
Techasuwanna, Ranida
Mongkalangoon, Noparat
Prasert, Kriengkrai
Puthavathana, Pilaipan
author_facet Lerdsamran, Hatairat
Mungaomklang, Anek
Iamsirithaworn, Sopon
Prasertsopon, Jarunee
Wiriyarat, Witthawat
Saritsiri, Suthee
Anusorntanawat, Ratikorn
Siriyakorn, Nirada
Intalapaporn, Poj
Sirikhetkon, Somrak
Sangsiriwut, Kantima
Dangsakul, Worawat
Sawadpongpan, Suteema
Thinpan, Nattakan
Kitidee, Kuntida
Okada, Pilailuk
Techasuwanna, Ranida
Mongkalangoon, Noparat
Prasert, Kriengkrai
Puthavathana, Pilaipan
author_sort Lerdsamran, Hatairat
collection PubMed
description This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, and 553 Thai citizens returning after spending extended periods of time in countries with a high disease prevalence. We recruited participants between May 2020 and May 2021, which spanned the first two epidemic waves and part of the third wave of the COVID-19 outbreaks in Thailand. Their sera were tested in a microneutralization and a chemiluminescence immunoassay for IgG against the N protein. Furthermore, we performed an immunofluorescence assay to resolve discordant results between the two assays. None of the prepandemic sera contained anti-SARS-CoV-2 antibodies, while antibodies developed in 88% (15 of 17) of the COVID-19 patients at 8–14 days and in 94–100% of the patients between 15 and 60 days after disease onset. Neutralizing antibodies persisted for at least 8 months, longer than IgG antibodies. Of the 2113 individuals at risk due to their occupation, none of the health providers, airport officers, or public transport drivers were seropositive, while antibodies were present in 0.44% of entertainment workers. Among the 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, seropositivity was present in 1.9, 1.5, and 7.5% of the Bangkok residents during the three epidemic waves, respectively, and in 1.3% of the Chiang Mai people during the first epidemic wave. The antibody prevalence varied between 6.5 and 47.0% in 553 Thai people returning from high-risk countries. This serosurveillance study found a low infection rate of SARS-CoV-2 in Thailand before the emergence of the Delta variant in late May 2021. The findings support the Ministry of Public Health’s data, which are based on numbers of patients and contact tracing.
format Online
Article
Text
id pubmed-9045619
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-90456192022-04-28 Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves Lerdsamran, Hatairat Mungaomklang, Anek Iamsirithaworn, Sopon Prasertsopon, Jarunee Wiriyarat, Witthawat Saritsiri, Suthee Anusorntanawat, Ratikorn Siriyakorn, Nirada Intalapaporn, Poj Sirikhetkon, Somrak Sangsiriwut, Kantima Dangsakul, Worawat Sawadpongpan, Suteema Thinpan, Nattakan Kitidee, Kuntida Okada, Pilailuk Techasuwanna, Ranida Mongkalangoon, Noparat Prasert, Kriengkrai Puthavathana, Pilaipan PLoS One Research Article This study determined the presence of anti-SARS-CoV-2 antibodies in 4964 individuals, comprising 300 coronavirus disease-19 (COVID-19) prepandemic serum samples, 142 COVID-19 patients, 2113 individuals at risk due to their occupations, 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, and 553 Thai citizens returning after spending extended periods of time in countries with a high disease prevalence. We recruited participants between May 2020 and May 2021, which spanned the first two epidemic waves and part of the third wave of the COVID-19 outbreaks in Thailand. Their sera were tested in a microneutralization and a chemiluminescence immunoassay for IgG against the N protein. Furthermore, we performed an immunofluorescence assay to resolve discordant results between the two assays. None of the prepandemic sera contained anti-SARS-CoV-2 antibodies, while antibodies developed in 88% (15 of 17) of the COVID-19 patients at 8–14 days and in 94–100% of the patients between 15 and 60 days after disease onset. Neutralizing antibodies persisted for at least 8 months, longer than IgG antibodies. Of the 2113 individuals at risk due to their occupation, none of the health providers, airport officers, or public transport drivers were seropositive, while antibodies were present in 0.44% of entertainment workers. Among the 1856 individuals at risk due to sharing workplaces or communities with COVID-19 patients, seropositivity was present in 1.9, 1.5, and 7.5% of the Bangkok residents during the three epidemic waves, respectively, and in 1.3% of the Chiang Mai people during the first epidemic wave. The antibody prevalence varied between 6.5 and 47.0% in 553 Thai people returning from high-risk countries. This serosurveillance study found a low infection rate of SARS-CoV-2 in Thailand before the emergence of the Delta variant in late May 2021. The findings support the Ministry of Public Health’s data, which are based on numbers of patients and contact tracing. Public Library of Science 2022-04-27 /pmc/articles/PMC9045619/ /pubmed/35476709 http://dx.doi.org/10.1371/journal.pone.0263316 Text en © 2022 Lerdsamran et al https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Lerdsamran, Hatairat
Mungaomklang, Anek
Iamsirithaworn, Sopon
Prasertsopon, Jarunee
Wiriyarat, Witthawat
Saritsiri, Suthee
Anusorntanawat, Ratikorn
Siriyakorn, Nirada
Intalapaporn, Poj
Sirikhetkon, Somrak
Sangsiriwut, Kantima
Dangsakul, Worawat
Sawadpongpan, Suteema
Thinpan, Nattakan
Kitidee, Kuntida
Okada, Pilailuk
Techasuwanna, Ranida
Mongkalangoon, Noparat
Prasert, Kriengkrai
Puthavathana, Pilaipan
Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title_full Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title_fullStr Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title_full_unstemmed Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title_short Seroprevalence of anti-SARS-CoV-2 antibodies in Thai adults during the first three epidemic waves
title_sort seroprevalence of anti-sars-cov-2 antibodies in thai adults during the first three epidemic waves
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9045619/
https://www.ncbi.nlm.nih.gov/pubmed/35476709
http://dx.doi.org/10.1371/journal.pone.0263316
work_keys_str_mv AT lerdsamranhatairat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT mungaomklanganek seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT iamsirithawornsopon seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT prasertsoponjarunee seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT wiriyaratwitthawat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT saritsirisuthee seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT anusorntanawatratikorn seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT siriyakornnirada seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT intalapapornpoj seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT sirikhetkonsomrak seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT sangsiriwutkantima seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT dangsakulworawat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT sawadpongpansuteema seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT thinpannattakan seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT kitideekuntida seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT okadapilailuk seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT techasuwannaranida seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT mongkalangoonnoparat seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT prasertkriengkrai seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves
AT puthavathanapilaipan seroprevalenceofantisarscov2antibodiesinthaiadultsduringthefirstthreeepidemicwaves