Cargando…
Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review
INTRODUCTION: Children and adolescents living with HIV (C/ALHIV) are at a risk for significant neurocognitive deficits. There is limited literature that addresses the role of socioeconomic factors in neurocognitive deficits among CALHIV in Sub Saharan Africa (SSA), as it is very difficult to establi...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9047261/ https://www.ncbi.nlm.nih.gov/pubmed/35477577 http://dx.doi.org/10.1186/s13034-022-00465-y |
_version_ | 1784695686162284544 |
---|---|
author | Musindo, Otsetswe Krabbendam, Lydiah Mutahi, Joan García, Miguel Pérez Bangirana, Paul Kumar, Manasi |
author_facet | Musindo, Otsetswe Krabbendam, Lydiah Mutahi, Joan García, Miguel Pérez Bangirana, Paul Kumar, Manasi |
author_sort | Musindo, Otsetswe |
collection | PubMed |
description | INTRODUCTION: Children and adolescents living with HIV (C/ALHIV) are at a risk for significant neurocognitive deficits. There is limited literature that addresses the role of socioeconomic factors in neurocognitive deficits among CALHIV in Sub Saharan Africa (SSA), as it is very difficult to establish this causal relationship. Our systematic review was guided by the biodevelopmental framework that assumes that foundations of health and adversity affect later development and life outcomes. This systematic review aims to assess available evidence on the relationship between neurocognitive deficits and socioeconomic factors among HIV children and adolescents in SSA region. METHOD: Using a pre-determined search strategy, we searched electronic databases including PubMed, web of Science and EBSCOhost (CINAHL and MEDLINE). Peer-reviewed publications that address neurocognitive deficits, psychosocial and socioeconomic risk factors among children and adolescents living with HIV in SSA were included in review. RESULTS: Out of 640 articles, 17 studies from SSA met the inclusion criteria. Four studies reported no significant differences in the neurocognitive measures comparing children and adolescents with HIV infection to those uninfected. However, 10 studies suggest that C/ALHIV scored significantly low in general intellectual functions as compared to their uninfected peers. C/ALHIV were found to have substantial deficits in specific cognitive domains such as sequential processing, simultaneous processing, and learning. In addition, deficits in visuo-spatial processing, visual memory and semantic fluency were mentioned. Socioeconomic factors such as lower socioeconomic status (income, education and occupation), child orphanhood status and under-nutrition were linked with neurocognitive deficits. CONCLUSION: Our findings suggest that CALHIV presented with poorer neurocognitive outcomes when compared to other populations which were associated with specific socioeconomic factors. |
format | Online Article Text |
id | pubmed-9047261 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-90472612022-04-29 Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review Musindo, Otsetswe Krabbendam, Lydiah Mutahi, Joan García, Miguel Pérez Bangirana, Paul Kumar, Manasi Child Adolesc Psychiatry Ment Health Review INTRODUCTION: Children and adolescents living with HIV (C/ALHIV) are at a risk for significant neurocognitive deficits. There is limited literature that addresses the role of socioeconomic factors in neurocognitive deficits among CALHIV in Sub Saharan Africa (SSA), as it is very difficult to establish this causal relationship. Our systematic review was guided by the biodevelopmental framework that assumes that foundations of health and adversity affect later development and life outcomes. This systematic review aims to assess available evidence on the relationship between neurocognitive deficits and socioeconomic factors among HIV children and adolescents in SSA region. METHOD: Using a pre-determined search strategy, we searched electronic databases including PubMed, web of Science and EBSCOhost (CINAHL and MEDLINE). Peer-reviewed publications that address neurocognitive deficits, psychosocial and socioeconomic risk factors among children and adolescents living with HIV in SSA were included in review. RESULTS: Out of 640 articles, 17 studies from SSA met the inclusion criteria. Four studies reported no significant differences in the neurocognitive measures comparing children and adolescents with HIV infection to those uninfected. However, 10 studies suggest that C/ALHIV scored significantly low in general intellectual functions as compared to their uninfected peers. C/ALHIV were found to have substantial deficits in specific cognitive domains such as sequential processing, simultaneous processing, and learning. In addition, deficits in visuo-spatial processing, visual memory and semantic fluency were mentioned. Socioeconomic factors such as lower socioeconomic status (income, education and occupation), child orphanhood status and under-nutrition were linked with neurocognitive deficits. CONCLUSION: Our findings suggest that CALHIV presented with poorer neurocognitive outcomes when compared to other populations which were associated with specific socioeconomic factors. BioMed Central 2022-04-27 /pmc/articles/PMC9047261/ /pubmed/35477577 http://dx.doi.org/10.1186/s13034-022-00465-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Musindo, Otsetswe Krabbendam, Lydiah Mutahi, Joan García, Miguel Pérez Bangirana, Paul Kumar, Manasi Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title | Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_full | Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_fullStr | Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_short | Neurocognitive deficits and socioeconomic risk factors among children and adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_sort | neurocognitive deficits and socioeconomic risk factors among children and adolescents living with hiv in sub-saharan africa: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9047261/ https://www.ncbi.nlm.nih.gov/pubmed/35477577 http://dx.doi.org/10.1186/s13034-022-00465-y |
work_keys_str_mv | AT musindootsetswe neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview AT krabbendamlydiah neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview AT mutahijoan neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview AT garciamiguelperez neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview AT bangiranapaul neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview AT kumarmanasi neurocognitivedeficitsandsocioeconomicriskfactorsamongchildrenandadolescentslivingwithhivinsubsaharanafricaasystematicreview |