Cargando…

A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids

Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. I...

Descripción completa

Detalles Bibliográficos
Autores principales: Guyot, Valentin, Rajeswaran, Rajendran, Chu, Huong Cam, Karthikeyan, Chockalingam, Laboureau, Nathalie, Galzi, Serge, Mukwa, Lyna F. T., Krupovic, Mart, Kumar, P. Lava, Iskra-Caruana, Marie-Line, Pooggin, Mikhail M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9049520/
https://www.ncbi.nlm.nih.gov/pubmed/35413079
http://dx.doi.org/10.1371/journal.ppat.1010448
_version_ 1784696155705180160
author Guyot, Valentin
Rajeswaran, Rajendran
Chu, Huong Cam
Karthikeyan, Chockalingam
Laboureau, Nathalie
Galzi, Serge
Mukwa, Lyna F. T.
Krupovic, Mart
Kumar, P. Lava
Iskra-Caruana, Marie-Line
Pooggin, Mikhail M.
author_facet Guyot, Valentin
Rajeswaran, Rajendran
Chu, Huong Cam
Karthikeyan, Chockalingam
Laboureau, Nathalie
Galzi, Serge
Mukwa, Lyna F. T.
Krupovic, Mart
Kumar, P. Lava
Iskra-Caruana, Marie-Line
Pooggin, Mikhail M.
author_sort Guyot, Valentin
collection PubMed
description Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed.
format Online
Article
Text
id pubmed-9049520
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-90495202022-04-29 A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids Guyot, Valentin Rajeswaran, Rajendran Chu, Huong Cam Karthikeyan, Chockalingam Laboureau, Nathalie Galzi, Serge Mukwa, Lyna F. T. Krupovic, Mart Kumar, P. Lava Iskra-Caruana, Marie-Line Pooggin, Mikhail M. PLoS Pathog Research Article Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed. Public Library of Science 2022-04-12 /pmc/articles/PMC9049520/ /pubmed/35413079 http://dx.doi.org/10.1371/journal.ppat.1010448 Text en © 2022 Guyot et al https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Guyot, Valentin
Rajeswaran, Rajendran
Chu, Huong Cam
Karthikeyan, Chockalingam
Laboureau, Nathalie
Galzi, Serge
Mukwa, Lyna F. T.
Krupovic, Mart
Kumar, P. Lava
Iskra-Caruana, Marie-Line
Pooggin, Mikhail M.
A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_full A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_fullStr A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_full_unstemmed A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_short A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_sort newly emerging alphasatellite affects banana bunchy top virus replication, transcription, sirna production and transmission by aphids
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9049520/
https://www.ncbi.nlm.nih.gov/pubmed/35413079
http://dx.doi.org/10.1371/journal.ppat.1010448
work_keys_str_mv AT guyotvalentin anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajeswaranrajendran anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chuhuongcam anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT karthikeyanchockalingam anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT laboureaunathalie anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT galziserge anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mukwalynaft anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT krupovicmart anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT kumarplava anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT iskracaruanamarieline anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT poogginmikhailm anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT guyotvalentin newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajeswaranrajendran newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chuhuongcam newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT karthikeyanchockalingam newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT laboureaunathalie newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT galziserge newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mukwalynaft newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT krupovicmart newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT kumarplava newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT iskracaruanamarieline newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT poogginmikhailm newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids